SecReT6
Protein ID: 386016262
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1672
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2024821..2026167 [-]
Producthypothetical protein
NoteTssK
UniProt IDF2EX44
KEGG IDpaj:PAJ_1672
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-150, Aligned region: 21..444
Protein Sequence: 448 a.a.     [Download]
>gi|386016262|ref|YP_005934548.1| hypothetical protein PAJ_1672 [Pantoea ananatis AJ13355]
MIMNRAEKVVWAEGMFLRPHHFQQAENFLQSSLREWGQSQRPYVWGFFDLEFDEALLRQGKLALSAASGC
LPDGTFFAFSQPQHGPAPLDVPSNTDRAKVVLAIPARRNGREAVTFQDAPDSLARYLAWEAEVEDDNAQA
VGTATVQFGKLRLRLMLEQDLTAEWTAMGVAQIVEKRSDNHIRLDNDYIPPTLTLAGSRPLQSMMTDLHG
MIQQRSQQLSQRAPGTGRFNSADMVDFMLLALLNRQLGLHAHLQHLPLLHPETLYSHWLQLAAELATWTE
ARTPDAFPLYDHDDLQGCFSRLTLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPDNSMVREFGFVLAV
KANVPADALKTHFPAQMKVAPVTKIRDLVQLQLPGLALKAMPGAPPQIPWHAGYSYFELDKNSELWQEME
RSGAFALHLAGEFPGLNMEFWAIRSQSE
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2026167-2024821 Pantoea ananatis AJ13355, complete genome
ATGATTATGAACAGAGCCGAAAAGGTTGTTTGGGCGGAAGGGATGTTTTTACGTCCTCACCATTTCCAGC
AGGCAGAAAACTTTCTGCAAAGCTCGCTGCGTGAATGGGGCCAGTCGCAACGCCCTTATGTTTGGGGATT
TTTCGATCTCGAATTTGATGAAGCGCTGTTGCGGCAGGGTAAACTGGCACTGAGCGCCGCCAGTGGATGC
CTGCCGGATGGAACGTTTTTTGCCTTCAGTCAGCCACAACACGGCCCTGCGCCGCTGGACGTTCCCAGCA
ATACCGACCGCGCCAAAGTGGTTTTGGCCATTCCCGCTCGCCGCAATGGTCGCGAGGCGGTGACGTTTCA
GGACGCGCCTGATTCGCTGGCTCGCTATCTGGCCTGGGAAGCGGAAGTTGAAGATGACAATGCGCAGGCT
GTCGGAACGGCCACCGTTCAGTTTGGCAAGCTACGCCTCCGCTTGATGCTGGAGCAGGATCTCACGGCGG
AATGGACGGCGATGGGCGTTGCTCAGATAGTTGAAAAGCGCAGCGACAACCATATCCGTTTAGACAATGA
TTATATCCCTCCCACGTTAACCCTTGCTGGCAGTCGTCCGCTTCAGAGCATGATGACCGACCTGCACGGC
ATGATTCAACAACGTAGCCAGCAGCTGAGCCAGCGCGCACCCGGAACGGGCCGCTTTAACAGCGCGGATA
TGGTTGATTTTATGCTGCTGGCGTTGCTTAACCGCCAGTTGGGCCTTCATGCGCATCTGCAGCATCTGCC
GCTATTACATCCCGAAACCCTCTACAGCCACTGGCTGCAGCTGGCTGCTGAGCTGGCAACGTGGACAGAG
GCGCGCACGCCGGATGCTTTCCCTCTCTATGACCACGACGACCTGCAGGGTTGCTTCTCCCGCCTGACGC
TATTACTCCGTCAGGGCCTGTCGCAGGTGATGGAAGAGAGCGCCATTCAGTTGCCGCTGACGCAACGCTC
ACACGGCCTGAACGTGGCGACCGTGCCGGATAACAGCATGGTGCGTGAATTCGGTTTTGTGCTGGCCGTA
AAAGCAAACGTCCCGGCCGACGCGCTGAAAACGCATTTTCCGGCGCAGATGAAAGTCGCCCCCGTCACCA
AAATTCGCGATCTCGTCCAACTGCAGCTACCGGGCCTTGCCCTGAAAGCCATGCCGGGTGCGCCACCGCA
GATCCCATGGCACGCAGGATACAGCTATTTTGAGCTGGATAAGAACAGCGAGCTATGGCAGGAGATGGAG
CGATCGGGTGCCTTCGCGCTGCACCTTGCCGGTGAGTTTCCGGGCCTGAACATGGAGTTCTGGGCCATTC
GCAGTCAGTCAGAATAA