SecReT6
Protein ID: 386016263
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1673
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2026183..2026686 [-]
Productlipoprotein hypothetical protein
NoteTssJ
UniProt IDF2EX45
KEGG IDpaj:PAJ_1673
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-27, Aligned region: 19..143
Protein Sequence: 167 a.a.     [Download]
>gi|386016263|ref|YP_005934549.1| lipoprotein hypothetical protein [Pantoea ananatis AJ13355]
MAQTYFRVGLAKWIWPFLLLLLTACSSSKPDIARYNLHFQAHPSINSGAPLKVRVMLLTSDAEFMSADFF
TLQNQPATALGNTLLNNQQFFLMSGQLSKTLSAKSLPDARFIGIMAEYQKLDGKVWRLALPFPDSDSSSF
WQFWKSNDGELNANIIVDDAGMRPVKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2026686-2026183 Pantoea ananatis AJ13355, complete genome
ATGGCACAAACTTACTTTCGCGTTGGCCTGGCAAAATGGATCTGGCCCTTCCTGCTGCTTCTGCTAACGG
CATGCAGTAGCAGTAAGCCTGATATTGCGCGATACAACCTGCACTTTCAGGCTCATCCTTCCATCAATTC
GGGCGCACCTCTCAAAGTCCGGGTGATGTTGCTGACGTCTGATGCAGAATTTATGTCCGCCGACTTCTTC
ACTCTGCAGAATCAACCCGCTACCGCACTGGGAAATACGCTGCTCAACAATCAGCAGTTTTTCCTGATGT
CCGGTCAGCTCAGTAAAACGCTGAGTGCCAAAAGCCTCCCCGACGCGCGCTTTATCGGCATCATGGCGGA
ATATCAAAAGCTGGATGGCAAGGTGTGGCGACTTGCGCTGCCTTTCCCAGACAGTGACAGCAGCTCGTTC
TGGCAGTTCTGGAAAAGCAATGATGGTGAGTTAAACGCCAACATTATCGTTGACGATGCCGGCATGCGTC
CCGTTAAGCAATAA