SecReT6
Protein ID: 386018494
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0135
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]143283..143780 [+]
Producthypothetical protein
NoteTssB
UniProt IDF2EZ75
KEGG IDpaj:PAJ_p0135
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|386018494|ref|YP_005941100.1| hypothetical protein PAJ_p0135 (plasmid) [Pantoea ananatis AJ13355] [TssB]
MTDSFQSEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGQESAPLPERKKVNLNKNNFDAVLSEY
SPKLNLTVKNTLAGDDSEENISLSFQSMRDFSPEQVSRQIPQLKAMLSMRNLLRDLKANLLDNQAFRKEL
EKILLDPALSAELRSELSALAPKQP
 
Nucleotide Sequence: 498 bp     [Download]
>gi|386018361|ref|NC_017533.1|:143283-143780 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence [TssB]
ATGACGGATAGTTTTCAGAGTGAAGTGCCAAAGGCACGTATTAATTTAAAACTGGATCTGCATACGGGGG
GCGCAAGCAAGAAAACGGAGCTCCCTCTGAAATTACTTGTGGCGGGCGACTTCAGTAATGGTCAGGAGTC
TGCACCCCTGCCTGAACGTAAAAAAGTTAATCTGAACAAAAATAATTTTGACGCTGTGCTTTCTGAATAT
TCACCAAAATTAAACCTGACCGTTAAAAATACGCTTGCCGGTGACGACAGCGAAGAAAACATCAGCCTGT
CATTCCAGAGCATGCGGGATTTTTCTCCAGAGCAGGTTTCCCGCCAAATACCCCAGCTGAAGGCCATGCT
TTCCATGCGCAATTTGCTGCGTGATTTAAAGGCAAATTTACTGGATAACCAGGCTTTTCGAAAAGAGCTG
GAAAAAATTCTGCTCGATCCGGCCTTAAGTGCAGAGCTCCGATCTGAGCTGTCTGCGCTGGCACCTAAAC
AGCCATAA