SecReT6
Protein ID: 386018495
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0136
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]143862..145361 [+]
Producthypothetical protein
NoteTssC
UniProt IDF2EZ76
KEGG IDpaj:PAJ_p0136
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.40E-176, Aligned region: 73..495
Protein Sequence: 499 a.a.     [Download]
>gi|386018495|ref|YP_005941101.1| hypothetical protein PAJ_p0136 [Pantoea ananatis AJ13355]
MLERPVAGGVYASLFEKINLNPVSELSALDIWQDAQAMSDATADERLTAGMQVFIECLTKSGSKVEKLDK
HLIDHHIAALDDQISRQLDAVMHHEDFQAVESLWRGVKSLVDKTDFRQNVKIELLDMSKEDLRQDFEDSP
EIIQSGLYKHTYIDEYDTPGGEPIAALISAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPTFFLKDS
MEEVAAIKDIGNYFDRAEYIKWKSFRETDDSRYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHDK
YLWTNASFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPSEVMIPETREFEFAN
LGFIPLSYYRNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKD
RRLLELELNTWVRSLVTEMSDPGDELQASHPLRDAKVTVEDIEDNPGFFRVKLYAIPHFQVEGMDVNLSL
VSQMPKAKS
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|386018361|ref|NC_017533.1|:143862-145361 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
GTGCTTGAACGTCCTGTCGCAGGTGGAGTTTATGCGTCCCTGTTTGAAAAAATTAATCTGAACCCGGTTT
CTGAGCTGAGTGCGCTGGATATCTGGCAGGATGCACAGGCGATGTCGGATGCGACTGCCGATGAACGATT
AACTGCCGGCATGCAGGTGTTTATCGAATGCCTGACAAAATCAGGCTCAAAAGTTGAAAAACTCGACAAG
CATCTGATTGACCATCACATCGCGGCGCTGGATGACCAGATTAGTCGTCAGCTTGATGCCGTTATGCATC
ACGAGGACTTTCAGGCAGTAGAAAGCCTGTGGCGCGGCGTGAAATCCCTTGTCGACAAAACCGATTTTCG
TCAGAACGTCAAAATTGAACTGCTGGATATGTCTAAAGAAGACCTGCGTCAGGACTTCGAAGACAGCCCC
GAAATTATCCAGAGCGGGCTGTATAAACATACCTATATTGATGAATACGATACGCCGGGTGGCGAGCCGA
TTGCCGCGCTGATTTCCGCTTACGAATTTGATGCGTCTGCGCAGGATGTCGCTCTGCTGCGCAACATTTC
GAAAGTGTCTGCCGCTGCGCATATGCCGTTTATCGGCTCTGCCGGCCCGACGTTCTTCCTCAAGGACTCC
ATGGAGGAAGTGGCGGCCATCAAGGATATTGGTAATTACTTTGACCGCGCGGAATACATCAAGTGGAAAT
CCTTTCGCGAAACAGACGATTCCCGCTACATCGGTCTGGTCATGCCGCGCGTACTGGGCCGCTTACCCTA
TGGTCCGGACACCGTGCCTGTTCGTAGTTTCAATTACGTGGAAGAAGTGAAAGGCCCGGATCATGACAAA
TACCTGTGGACCAACGCCTCGTTTGCTTTTGCCTCCAATATGGTGCGCAGCTTCATCAATAACGGCTGGT
GCGTGCAAATTCGTGGCCCGCAGGCCGGTGGTGCCGTTCAGGACCTGCCAATCCATCTGTACGATCTGGG
TACTGGCAATCAGGTGAAGATCCCGAGTGAGGTGATGATCCCTGAAACCCGCGAATTTGAATTTGCCAAT
CTGGGATTCATTCCTTTGTCCTATTACCGCAATCGTGACTATGCGTGCTTCTTCTCGGCTAACTCGACCC
AGAAACCGGCACTCTATGATACAGCGGATGCAACGGCTAACAGCCGTATCAATGCCCGTCTGCCATACAT
TTTCCTGCTGTCGCGCATTGCGCACTATCTGAAGCTTATCCAGCGCGAAAACATCGGTACGACGAAAGAC
CGTCGTCTACTGGAGCTGGAGTTGAACACCTGGGTGCGCAGTCTGGTAACGGAAATGAGCGATCCGGGTG
ATGAGCTACAGGCTTCTCACCCACTGCGTGACGCGAAAGTGACAGTGGAAGATATTGAGGATAACCCGGG
TTTTTTCCGCGTGAAACTGTACGCGATCCCGCACTTCCAGGTAGAGGGCATGGACGTCAACCTGTCACTG
GTTTCTCAGATGCCCAAGGCGAAATCATAA