SecReT6
Protein ID: 386018496
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0137
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]145379..146719 [+]
Producthypothetical protein
NoteTssK
UniProt IDF2EZ77
KEGG IDpaj:PAJ_p0137
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.80E-136, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|386018496|ref|YP_005941102.1| hypothetical protein PAJ_p0137 [Pantoea ananatis AJ13355]
MKTEQPLWGRGVMISPQHFQQQVAYAAWSAESIARMGLSQPWGVINVAFEPETLKLGRLQARHLHIRFPD
GTLIDTDNADDLPPVLALESESQDVVVVLALPLLRANGGNCLKPDEVAERPVRYRQRWRDVRNTFGDDIR
QIAVMQPELTLRFAHQDNSDYLTCPVARLQQDSQGSWQLDETFLPPLLSIQGSRWLVSQLEQLMTQLRAR
LSRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRHPQSPPERLYPELARLAGSLLTFSLE
HQVSAIPVWQFMQLNNVFPPLFDLLSDLLEASLPSRVVAIELENDARLHVWQARLHDQRLREGADYYLSV
RSPMPAAQLQEQFPHQCKVGSPDHVRSIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QGGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|386018361|ref|NC_017533.1|:145379-146719 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCGTAATGATCTCTCCTCAACACTTCCAGCAACAGGTCG
CGTATGCGGCCTGGTCTGCCGAAAGTATCGCCAGGATGGGGTTATCACAGCCCTGGGGCGTGATAAATGT
CGCTTTTGAACCGGAAACGCTGAAACTGGGCCGCCTGCAGGCCCGCCATCTGCACATTCGTTTCCCTGAC
GGAACGCTAATCGATACGGATAATGCTGACGATCTACCGCCGGTGCTGGCGCTTGAAAGTGAGTCACAGG
ACGTGGTGGTGGTTCTGGCGCTTCCGCTGCTGCGGGCGAATGGTGGCAACTGCCTTAAACCTGATGAGGT
GGCCGAGCGTCCGGTTCGTTATCGCCAGCGCTGGCGCGATGTACGCAATACTTTTGGCGACGATATCCGC
CAGATTGCGGTGATGCAGCCAGAGCTGACGCTGCGGTTTGCCCATCAGGACAACAGCGATTATCTGACCT
GCCCGGTTGCCCGCCTGCAGCAGGATTCGCAGGGTTCATGGCAACTTGATGAGACGTTTCTTCCTCCGCT
TTTGTCCATCCAGGGCAGCCGCTGGCTGGTGAGTCAGTTGGAACAGTTGATGACGCAACTACGTGCCCGT
CTGAGTCGTCTGATGGCCATGCGCCGTGAAAGTAACGAACGTATGGCTGATTTTGCCGTGGCCGACGTGT
CCTTGTTCTGGCTGCTTAATGCCCTGAACAGCGCTGAGCCTGTGCTGGGGCAGTTTCAGCGTCACCCGCA
AAGCCCGCCGGAGCGTCTGTATCCGGAACTTGCGCGGCTTGCGGGCAGCCTGCTGACCTTCTCACTCGAA
CACCAGGTGAGTGCGATTCCTGTCTGGCAGTTTATGCAACTAAATAACGTCTTCCCGCCGCTGTTTGATT
TACTCAGCGACCTGCTGGAAGCCAGTCTGCCATCGCGGGTGGTGGCGATTGAGCTCGAAAATGATGCCCG
GCTTCATGTCTGGCAGGCGCGTTTGCATGACCAACGTCTGCGCGAAGGCGCAGATTACTATCTCTCTGTG
CGATCCCCGATGCCGGCGGCACAACTGCAGGAACAGTTCCCGCATCAGTGCAAGGTCGGCAGTCCCGATC
ATGTCAGGAGTATCGTCAATTCATCGCGGGTGGGCGTACCTCTGACGCCACTGCGCCATGTGCCGGCAGC
CATTCCGCTGCGTCTGGAAAACCAGTATTTCAGCCTGGATGTCTCTCATCCCCTTGCCACCGAAATGCTT
CAGGGCGGCACCTGTATGTTTTACGTCCCTGGCATGCTCGGTGAGCCTGAACTTGAACTCTTCGCGGTAC
TGAGAACATGA