SecReT6
Protein ID: 386018497
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0138
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]146716..147405 [+]
Producthypothetical protein
NoteTssL
UniProt IDF2EZ78
KEGG IDpaj:PAJ_p0138
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-39, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|386018497|ref|YP_005941103.1| hypothetical protein PAJ_p0138 [Pantoea ananatis AJ13355]
MSEHKRGAAASIDIDALLQDTWLQVISLRHGPEFHDGEGRTLWERCIADVGRVQRELKASELDETSCQHI
LTAQCALLDEAVKGRGVEDDACVQWYHIPLQGHFLGTMDAGDTLCDRMRDVLREPAPDNTVVTCFQRVMM
LGFLGSFRALDDPERQKLVKALSEHVAPFSYPQTHPVVVESRIRRGTGGWMASWPLRIGLSVVVVAALWW
GLDHWLDRTLFTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|386018361|ref|NC_017533.1|:146716-147405 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGAGTGAGCATAAACGCGGCGCTGCCGCATCCATTGATATTGATGCCCTGCTGCAGGATACCTGGCTGC
AGGTGATCAGCCTGCGTCACGGCCCTGAATTTCACGATGGCGAAGGGCGCACGCTTTGGGAGCGCTGCAT
CGCTGATGTCGGGCGAGTGCAGCGCGAGCTGAAAGCGAGTGAACTTGATGAAACCAGCTGCCAGCATATT
CTCACTGCACAGTGCGCGCTGCTCGATGAGGCGGTCAAAGGTCGTGGTGTGGAAGATGACGCCTGTGTGC
AGTGGTATCACATTCCCCTGCAGGGGCACTTCCTCGGCACAATGGACGCCGGAGATACGCTGTGCGATCG
GATGCGCGATGTGCTGCGTGAACCGGCTCCTGACAATACAGTGGTGACCTGCTTCCAGCGGGTCATGATG
CTGGGATTCCTCGGCAGTTTTCGCGCGCTGGACGATCCGGAACGTCAGAAACTCGTCAAAGCACTCAGCG
AACATGTTGCGCCGTTCAGCTATCCACAAACCCATCCGGTAGTGGTGGAAAGTCGTATCAGAAGGGGCAC
GGGCGGCTGGATGGCATCATGGCCTTTGCGTATTGGCTTGAGCGTTGTCGTGGTGGCCGCACTATGGTGG
GGACTGGATCACTGGCTGGATCGGACGCTGTTTACCCTGTTGCCGGGAGCCGTAAAATGA