SecReT6
Protein ID: 386018499
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0140
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]149131..149622 [+]
Producthemolysin Co-regulated protein Hcp
NoteTssD
UniProt IDF2EZ80
KEGG IDpaj:PAJ_p0140
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386018499|ref|YP_005941105.1| hemolysin Co-regulated protein Hcp [Pantoea ananatis AJ13355]
MAIPVYLWLQDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKDPSFEKHNHLERIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386018361|ref|NC_017533.1|:149131-149622 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGGCAATTCCTGTTTATCTCTGGCTACAAGACGACGGCGGCGCGGACATCAAGGGTTCGGTTGACGTTC
AGGATCGTGAAGGCAGCATCGAAGTGGTCGCGCAGGAGCACAACCTGTACATCCCGACCGATAACAACAC
CGGCAAGCTGACCGGCACCCGTATTCATACGCCGTTCCTGTTCACCAAGGAAATCGATTCGTCCAGCCCG
TATCTCTACAAGGCGGTAACCACCGGTCAGACCCTCAAGTCTGCGGAATTCAAATGGTACAAAATCAACG
ATGCGGGTCAGGAAGTGGAGTACTTCAACACCAAACTGGAAAACGTGAAGGTGGTGAAGGTGAACCCCGT
GATGCATGACATCAAAGATCCTTCTTTTGAGAAGCACAACCACCTTGAGCGCATCGAACTGCGTTACGAA
AAAATCACCTGGACCTATAAAGACGGCAACATCATCCATTCCGATTCCTGGAACGAACGCGCTACCGCGT
AA