SecReT6
Protein ID: 386018500
SecReT6 ID608
T6SS typei2
Gene symbolclpV
Locus tagPAJ_p0141
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]149796..152456 [+]
Productchaperone ClpV
NoteTssH
UniProt IDF2EZ81
KEGG IDpaj:PAJ_p0141
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.10E-41, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 8.10E-41, Aligned region: 610..775
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 238..350
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 615..736
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 764..780
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 336..368
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 614..735
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 383..406
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 781..856
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 215..258
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 491..559
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 595..650
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 754..799
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 367..398
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 611..637
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 776..813
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 238..265
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 292..327
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 610..643
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 216..252
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 290..388
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 607..635
Arch_ATPase [PF01637], Evalue: 3.20E-07, Aligned region: 684..696
AAA_19 [PF13245], Evalue: 2.50E-06, Aligned region: 235..258
AAA_19 [PF13245], Evalue: 2.50E-06, Aligned region: 546..594
AAA_19 [PF13245], Evalue: 2.50E-06, Aligned region: 610..636
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 238..303
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 613..649
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 797..819
Clp_N [PF02861], Evalue: 7.90E-06, Aligned region: 22..54
Clp_N [PF02861], Evalue: 7.90E-06, Aligned region: 101..126
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 103..132
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 238..266
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 614..633
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 232..258
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 500..521
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 614..632
AAA_18 [PF13238], Evalue: 2.40E-05, Aligned region: 238..279
AAA_18 [PF13238], Evalue: 2.40E-05, Aligned region: 615..639
Sigma54_activat [PF00158], Evalue: 3.00E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 3.00E-05, Aligned region: 607..731
Zeta_toxin [PF06414], Evalue: 4.10E-05, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 4.10E-05, Aligned region: 601..654
AAA_29 [PF13555], Evalue: 5.30E-05, Aligned region: 232..255
AAA_29 [PF13555], Evalue: 5.30E-05, Aligned region: 610..640
AAA_14 [PF13173], Evalue: 8.50E-05, Aligned region: 238..336
AAA_14 [PF13173], Evalue: 8.50E-05, Aligned region: 612..696
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 224..255
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 613..626
DUF258 [PF03193], Evalue: 0.0019, Aligned region: 790..810
AAA_23 [PF13476], Evalue: 0.0022, Aligned region: 238..264
AAA_23 [PF13476], Evalue: 0.0022, Aligned region: 496..535
AAA_23 [PF13476], Evalue: 0.0022, Aligned region: 611..637
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 239..259
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 712..733
SRP54 [PF00448], Evalue: 0.0057, Aligned region: 238..258
SRP54 [PF00448], Evalue: 0.0057, Aligned region: 613..641
ABC_tran [PF00005], Evalue: 0.0072, Aligned region: 52..126
ABC_tran [PF00005], Evalue: 0.0072, Aligned region: 238..255
ABC_tran [PF00005], Evalue: 0.0072, Aligned region: 473..526
ABC_tran [PF00005], Evalue: 0.0072, Aligned region: 613..637
Protein Sequence: 886 a.a.     [Download]
>gi|386018500|ref|YP_005941106.1| chaperone ClpV [Pantoea ananatis AJ13355]
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDSIWQDLL
GWLDRQPRSVRQRPQLSEPIQVLMQEAWLIASLNGEEQIRSHHLLMALIEKQSLARCDGLWPLLTLGRGQ
LERLRPLLDAQSDERPELQFEVELAQEHGSEVEFVGRPVGAELKEGELTPSLQNALDKFTLDVTAKAKEG
KIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAGGNVPDSLKSVALRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPVPILLFIDEAHTIIGAGNQSGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTAAARVRMSLDTVPDAIVRLKAQLTALALEEQALLDDVAAGSHRHGDRLGVIEQLRAELD
AHIQMQESRFSHKKALAQQLMTSRQDISQRDEIIDLQQQLEQAQQGDALVQIDVDTRTIANVIADWTGVP
LSSLMKDEQTELLTLENEIGRRVVGQQPSLKAIAQRLRAAKTGLTSENGPQGVFLLVGPSGVGKTETALA
LAEVLYGGEKSLITLNLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHLMQRLDEQPDATEGDLHELLRPILCEHFQPALL
ARFQTVIYRPLSQAAMRTIVEMKLGQVSQRLNRHYGLTTHIDESLYDALTAACLLPDTGARNVDSLLNQQ
ILPVLSQQLLTHMAAKQKPQSLCLSWSEEEGIGLAFAPLRECTHEQ
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|386018361|ref|NC_017533.1|:149796-152456 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGGAAAATCCAGCCATCCTGTTGCGACGTCTGAACCCTTACTGTGCCCGTGCGATGGAAGGGGCGGCTT
CGCTCTGCCAGACCCGCGCCCACGCGGAAATTTTGCCGGAGCACTGGCTGCTGAAACTGCTGGAGCAGGG
CGAGGGCGATCTCACGGTACTGGCGCGACGTTATGAATGGGATATGGACAGCATCTGGCAGGATTTGCTG
GGCTGGCTGGATCGACAACCGCGCTCAGTGCGCCAACGTCCACAACTCTCCGAACCTATCCAGGTGTTGA
TGCAGGAAGCCTGGCTGATTGCTTCGCTCAACGGTGAAGAACAGATCCGCAGTCACCACCTGTTGATGGC
CTTAATTGAAAAACAGAGTCTGGCCCGCTGCGATGGTCTGTGGCCGCTACTGACGCTGGGCCGGGGACAA
CTGGAGCGCTTGCGACCGCTGCTGGATGCGCAGTCCGACGAACGCCCGGAGCTGCAGTTTGAGGTTGAAC
TGGCCCAGGAGCATGGCAGTGAGGTGGAGTTTGTTGGCCGCCCGGTCGGTGCAGAGCTGAAAGAGGGCGA
GCTGACCCCGTCCCTGCAGAACGCACTGGATAAATTCACTCTTGATGTCACTGCCAAAGCCAAAGAAGGC
AAGATTGATCCGGTATTTGGCCGCGATACTGAAATCCGTCAGATGGTGGACATTCTCTCCCGCCGCCGCA
AGAACAACCCAATCCTGGTCGGTGAACCAGGCGTGGGTAAAACCGCGCTGGTTGAAGGCCTGGCGCTGCG
TATAGCCGGAGGCAATGTACCGGATTCACTCAAGTCAGTTGCTCTGCGCACGCTTGATCTTGGGCTGTTG
CAGGCAGGGGCGGGCGTGAAAGGCGAGTTCGAACAGCGCCTCAAAAACGTCATTGATGCCGTGCAGCAGT
CGCCAGTGCCGATACTGCTGTTTATCGATGAGGCGCACACCATTATCGGGGCGGGCAACCAGTCGGGCGG
TGCCGATGCCGCTAACCTACTGAAACCCGCACTCGCCCGTGGCGAACTGCGCACCATTGCCGCCACGACC
TGGTCTGAATATAAGCAGTACTTCGAGCGCGATGCCGCGCTGGAACGTCGCTTCCAGATGGTGAAAGTGG
ACGAGCCCGACGATGACACGGCCTGCCTGATGCTGCGGGGCCTGAAATCCCGCTATGCCGAACATCACGG
CGTGCACATTACCGACGATGCGGTGCGGGCTGCCGTTACGCTTTCCCGACGTTATTTAACAGGCCGCCAG
TTGCCGGACAAGGCCGTGGATCTGCTGGATACTGCCGCCGCACGTGTACGTATGAGTCTTGATACCGTTC
CGGACGCCATTGTGCGCCTCAAAGCACAACTTACCGCGCTGGCGCTGGAAGAGCAGGCGCTGCTGGACGA
TGTCGCCGCCGGCAGTCATCGCCATGGTGATCGCCTGGGCGTTATTGAACAACTGCGGGCTGAGCTGGAC
GCACATATTCAGATGCAGGAAAGCCGCTTCAGCCACAAAAAAGCGCTGGCGCAGCAGTTGATGACCAGCC
GGCAGGACATCAGCCAGCGAGATGAAATTATTGACCTGCAACAGCAACTTGAACAGGCGCAGCAGGGGGA
TGCGCTGGTTCAGATCGATGTGGATACGCGCACGATCGCAAATGTTATCGCCGACTGGACCGGCGTGCCG
TTGTCTTCCCTGATGAAAGACGAACAGACGGAACTGCTGACTCTGGAAAACGAAATCGGCCGCCGTGTCG
TCGGCCAGCAGCCTTCCCTTAAAGCCATCGCCCAGCGCCTGCGCGCGGCGAAAACCGGGCTTACTTCCGA
AAATGGCCCACAGGGCGTGTTCCTGCTGGTTGGCCCGAGTGGCGTCGGCAAAACCGAAACCGCGCTGGCG
CTGGCTGAAGTGCTGTACGGCGGCGAAAAATCGCTGATTACCCTTAACCTGTCCGAATACCAGGAGCCAC
ATACCGTATCGCAACTGAAAGGCTCGCCACCGGGTTATGTCGGCTACGGCCAGGGCGGTATCCTCACCGA
AGCTGTGCGCAAGCGTCCCTATAGCGTGGTCCTGCTCGATGAAGTGGAAAAAGCGCACCGTGACGTGATG
AACCTGTTCTATCAGGTGTTTGATCGCGGCTTTATGCGCGACGGTGAAGGGCGGGAAATCGACTTCCGCA
ACACGGTTATTCTGATGACCTCGAACCTGGGCAGCGACCACCTGATGCAGCGGTTGGATGAACAACCAGA
CGCCACCGAAGGCGACCTGCACGAACTGCTGCGCCCGATCTTATGTGAGCACTTCCAGCCCGCGCTGCTG
GCCCGCTTCCAGACGGTAATTTACCGCCCGCTGTCGCAAGCGGCGATGCGCACCATCGTGGAGATGAAAC
TGGGGCAGGTAAGCCAGCGCCTGAATCGTCACTATGGCCTGACCACGCATATTGATGAGAGCCTGTACGA
TGCGCTGACGGCGGCCTGCCTGCTGCCGGACACCGGTGCACGCAACGTTGACAGCCTGCTCAATCAACAA
ATTCTGCCCGTGCTGAGTCAGCAGTTGCTGACCCACATGGCGGCGAAACAGAAACCACAGTCGCTATGCC
TCAGCTGGAGTGAAGAAGAGGGTATCGGGCTGGCGTTCGCCCCACTCAGGGAGTGCACGCATGAACAGTA
A