SecReT6
Protein ID: 386018501
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0142
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]152395..154797 [+]
Producthypothetical protein
NoteTssI
UniProt IDF2EZ82
KEGG IDpaj:PAJ_p0142
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-64, Aligned region: 51..373
DUF2345 [PF10106], Evalue: 2.80E-44, Aligned region: 629..770
T6SS_Vgr [PF13296], Evalue: 1.20E-35, Aligned region: 506..611
T6SS_Vgr [PF13296], Evalue: 1.20E-35, Aligned region: 646..671
Phage_base_V [PF04717], Evalue: 2.20E-16, Aligned region: 406..499
Protein Sequence: 800 a.a.     [Download]
>gi|386018501|ref|YP_005941107.1| hypothetical protein PAJ_p0142 [Pantoea ananatis AJ13355]
MKKRVSGWRSPHSGSARMNSNSPIRFSHNHHLLSVKGCEAATDVLAFEGDEALSTPFSYRIEFTSADHAI
SKEMMLMKAASLTLQAPVDQGYGIRMQQAVRVIQGVVSGFERLSTSRDETRYALTLRPRLALLDRSHQNA
IYQDMSVPQIVEKILRERHNMRGQDFLFSLSKEYPRREQVMQYGEDDLHFIIRLLGEVGIWFRFTTDTRL
NIDVVEFYDDRQGYEKGLTLPSVPPSGQHSQGEEAVWGMECHHSVVQKQVSTRDYNYRQATEDMNARVDV
TRGDITTYGDAYHFADNYLTRGSAHDRNPAPESGAFYARIRHERYLNGQTRVRAVTGCPTLSPGRVLKVT
GGYEVAEAFAHGVVITAMRSHARRDEGFGVHFEGIPDGTDFCFRPEPGKRPVMAGTLPARVTSTTGNDTY
GHIDKDGRYRVNMLFDRDNWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYISGVL
HDSAHGDHVTIRNYKRNVLRTPANNKIRLDDSRGREHIKVSTEYGGKSQLNLGHLVDSEKQKRGEGFELR
TDSWGAIRAQKGLFISADGQTKAQGQVLEMQPAVSNLGDAREQMTSISDDAQKATANPADLQAQIKLLEQ
QLTDLKKSVLLLSAPDGMALTSGQHLQVSAGQNLIATAGKNADVSVVKNLFIGVGNALSVFVRKLGIKLI
ANQGSVRIQAQNDLMELIARGEISVVSTEDRIEILAKKQVTINGGGSYITLDANGIESATQGEYRTKAGH
YGRKEKANKSEDFPNVAPETAEPSSKFSFS
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|386018361|ref|NC_017533.1|:152395-154797 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
GTGAAGAAGAGGGTATCGGGCTGGCGTTCGCCCCACTCAGGGAGTGCACGCATGAACAGTAATTCCCCGA
TCAGATTCAGCCACAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCGCGACTGACGTGCTGGCGTT
TGAAGGTGACGAGGCCCTGAGCACGCCGTTCAGCTACCGCATTGAGTTCACCAGCGCTGACCATGCCATC
AGCAAGGAGATGATGCTGATGAAGGCCGCCTCCCTGACGCTGCAGGCCCCGGTTGACCAGGGCTACGGCA
TCAGAATGCAGCAGGCCGTGCGAGTGATTCAGGGCGTGGTGAGCGGCTTTGAACGTCTCAGCACCTCCAG
GGACGAAACCCGTTACGCCCTGACGCTCCGGCCACGCCTGGCGCTGCTTGACCGCTCGCACCAGAACGCG
ATTTATCAGGACATGTCCGTCCCGCAAATCGTGGAAAAAATCCTGCGCGAGCGTCACAACATGCGCGGTC
AGGATTTTCTGTTCTCGCTGTCAAAAGAGTACCCGCGCCGCGAGCAGGTGATGCAGTACGGCGAGGACGA
CCTGCACTTTATCATCCGTCTGCTGGGCGAGGTGGGCATCTGGTTCCGCTTCACCACCGACACGCGCCTG
AACATCGACGTGGTGGAGTTTTACGACGACCGTCAGGGTTACGAGAAAGGCCTGACGCTGCCGTCGGTGC
CGCCCTCCGGGCAGCACTCGCAGGGTGAGGAGGCGGTCTGGGGGATGGAATGCCACCACAGCGTGGTACA
GAAGCAGGTCAGCACCCGCGACTACAACTACCGCCAGGCCACGGAAGACATGAACGCCCGGGTGGACGTG
ACCCGGGGCGATATCACCACCTACGGCGATGCCTATCACTTCGCCGATAACTACCTGACCCGGGGCAGCG
CCCACGACCGCAACCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGCATCCGGCACGAGCGCTACCTGAA
CGGCCAGACGCGGGTTCGTGCCGTCACCGGCTGCCCGACGCTTTCCCCCGGCCGGGTGCTGAAGGTGACG
GGCGGCTATGAGGTGGCGGAGGCGTTCGCGCATGGCGTGGTCATCACGGCGATGCGCAGCCACGCGCGGC
GGGACGAAGGCTTCGGGGTGCATTTTGAGGGCATCCCGGACGGCACTGATTTTTGCTTTCGTCCGGAGCC
CGGCAAACGCCCGGTGATGGCCGGGACGTTACCGGCCCGCGTCACCAGTACCACCGGGAACGACACCTAC
GGCCACATCGATAAAGACGGACGCTATCGCGTCAACATGCTGTTTGACCGTGATAACTGGGAAACAGGGT
TCGAGAGCCTGTGGGTGCGCCAGTCACGCCCGTATGCCGGGGATACCTATGGCCTGCACCTGCCGCTGCT
GGCGGGCACCGAAGTGGCGATTGGGTTTGAGGACGGTAATCCGGACAGGCCGTACATTTCTGGCGTACTT
CACGACTCGGCGCACGGCGACCACGTCACCATCCGCAACTACAAACGTAACGTTCTGCGCACGCCGGCGA
ACAACAAAATCCGCCTGGATGACAGCCGTGGTCGGGAGCATATCAAGGTTTCGACCGAGTACGGCGGCAA
GAGCCAGCTGAATCTCGGACATCTGGTTGACAGCGAAAAACAGAAGCGGGGTGAGGGCTTTGAACTGCGC
ACGGACAGCTGGGGTGCGATTCGGGCGCAGAAAGGGTTGTTCATCAGCGCTGATGGCCAGACGAAAGCAC
AGGGTCAGGTGCTGGAGATGCAGCCAGCGGTGAGCAATCTGGGTGATGCCCGGGAGCAGATGACGTCCAT
CTCCGATGATGCGCAGAAGGCGACCGCGAACCCGGCCGATCTCCAGGCACAAATCAAACTGCTGGAACAG
CAACTGACAGACCTCAAAAAGTCAGTGCTGCTGCTCAGCGCGCCGGATGGAATGGCACTAACCAGCGGGC
AACATCTACAGGTATCTGCCGGGCAGAACCTGATAGCCACTGCCGGTAAAAATGCCGACGTCAGCGTGGT
GAAAAATCTGTTCATCGGGGTGGGTAATGCCCTGAGCGTGTTTGTCCGTAAGCTGGGGATCAAGCTCATC
GCGAACCAGGGGTCGGTGAGGATCCAGGCACAGAATGACCTGATGGAGCTCATCGCTCGTGGAGAAATCA
GCGTCGTCAGTACCGAAGATCGTATCGAGATTCTTGCCAAGAAGCAGGTCACGATCAACGGGGGTGGAAG
CTATATCACCCTCGATGCCAATGGCATTGAATCAGCCACACAGGGGGAGTACCGGACTAAAGCCGGGCAT
TACGGGCGAAAAGAAAAGGCTAACAAGTCAGAAGACTTCCCGAATGTGGCTCCTGAAACCGCAGAACCTT
CCAGTAAATTCAGCTTTTCCTGA