SecReT6
Protein ID: 386018509
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0150
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]163758..165359 [+]
Producthypothetical protein
NoteTssA
UniProt IDF2EZ90
KEGG IDpaj:PAJ_p0150
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.30E-23, Aligned region: 67..126
Protein Sequence: 533 a.a.     [Download]
>gi|386018509|ref|YP_005941115.1| hypothetical protein PAJ_p0150 [Pantoea ananatis AJ13355]
MSTLQNLIVACQADDAQLQQQAQRHTENWQPWLAPITDASPTGEDPGYDDDFLRIREEVNKLSGIDTGLI
CTLAEKLLTTTAKDIRIATYYCWARLHQDGENGFAEGLELLAGLLQRYGTQLHPQRERSRKPALEWLAGS
RVLDSLSLWPEVVRDDALRTAGALLLIRDSLETEPEASRPELNALYSALESRLMKAGGVDAVVPQNAANK
AQLQAPSHITKPDAPLLSRITSGQDLLAQARTLTAYLREQPNGWLAAHRLMKSLRHDTLHSIPAPDAQGK
TRIEPPRADQRAMLKRLYLQQSWLEILEQADSTFSRGANHLWLDLQWYIHQALVKSGQDISADIITADLK
GLLRRLTGLETLAFNDGTPFADEVTLNWINQSVLDDMPGWCDEPVSAVSETDNGILALEPEALEKADTDG
LDATLHWLQTRPGTDATKDKWLLRLLMARVAEQKGKNELALHLLEELDSAAQSITLTQWTPALLFEVKSR
RLRLLRMKASRSESDKARLQPEMDLLMSGLIALDPASSVVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|386018361|ref|NC_017533.1|:163758-165359 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGAGCACTCTACAGAATCTGATCGTGGCCTGTCAGGCTGACGATGCCCAGCTGCAGCAACAGGCGCAGA
GACACACAGAAAACTGGCAGCCCTGGCTTGCTCCGATAACTGACGCCAGTCCGACCGGAGAAGACCCCGG
CTATGACGATGATTTTCTCCGTATCCGGGAGGAGGTCAATAAGCTTTCCGGCATCGATACCGGGCTGATT
TGCACACTTGCTGAAAAACTGCTGACCACCACAGCCAAAGATATCCGGATTGCCACCTATTACTGCTGGG
CGCGTCTGCACCAGGACGGGGAAAACGGATTTGCCGAAGGGCTTGAACTGCTGGCGGGATTGCTACAGCG
CTATGGAACGCAGCTTCATCCTCAGCGTGAGCGGAGCCGTAAACCGGCGCTGGAGTGGCTCGCAGGCTCC
CGCGTTCTGGACAGCCTGTCACTCTGGCCGGAAGTAGTGCGCGACGATGCCCTGCGCACTGCCGGCGCAC
TGCTGCTTATTCGCGACAGTCTGGAGACCGAGCCGGAAGCGTCACGCCCAGAACTGAATGCCCTGTACAG
CGCGCTGGAGTCTCGCCTGATGAAGGCCGGTGGCGTGGATGCCGTGGTCCCGCAAAACGCCGCTAATAAA
GCACAGTTGCAGGCCCCCTCACACATCACCAAACCTGACGCACCGCTACTAAGCCGTATCACGTCCGGTC
AGGATCTGCTGGCCCAGGCCCGTACACTGACGGCGTATCTGCGTGAACAACCCAATGGCTGGCTTGCCGC
ACACCGGCTGATGAAAAGCCTGCGTCATGACACATTGCACAGTATTCCTGCCCCGGATGCACAGGGGAAA
ACCCGAATCGAACCGCCGCGCGCTGACCAGCGGGCGATGCTCAAACGCCTGTACCTGCAGCAGAGCTGGC
TGGAGATACTGGAGCAGGCGGACAGCACCTTTTCGCGCGGTGCCAATCATCTCTGGCTGGATTTGCAGTG
GTATATCCATCAGGCCCTGGTGAAGTCGGGTCAGGACATCTCTGCCGATATTATCACCGCCGACCTGAAA
GGGCTGCTGCGTCGCCTTACTGGGCTTGAAACGCTGGCCTTCAACGACGGTACGCCGTTTGCCGATGAAG
TCACGCTGAACTGGATAAATCAGAGCGTGCTCGACGATATGCCGGGCTGGTGTGATGAACCGGTCAGTGC
CGTCAGTGAGACAGATAACGGTATCCTGGCACTTGAACCGGAAGCGCTGGAGAAAGCGGACACTGACGGC
CTGGATGCCACACTTCACTGGCTGCAGACCCGTCCGGGCACCGACGCCACGAAAGACAAATGGTTGCTGC
GTTTGCTGATGGCCCGGGTGGCTGAGCAGAAGGGAAAGAATGAACTGGCCCTGCATCTGTTGGAAGAGCT
CGACAGTGCCGCGCAGTCCATCACGCTCACGCAGTGGACACCGGCACTGTTGTTTGAAGTGAAATCCCGT
CGACTCAGACTGCTGCGCATGAAAGCCAGCCGTAGCGAAAGCGATAAAGCGCGGCTTCAGCCTGAGATGG
ACTTACTGATGTCCGGTCTGATTGCGCTCGATCCGGCAAGCAGTGTGGTGCTTTGCGGGTAA