SecReT6
Protein ID: 386018515
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0156
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]170526..172280 [+]
Producthypothetical protein
NoteTssF
UniProt IDF2EZ96
KEGG IDpaj:PAJ_p0156
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.80E-179, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|386018515|ref|YP_005941121.1| hypothetical protein PAJ_p0156 [Pantoea ananatis AJ13355]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSMSVVEFTPDWREMKEPMRIVKGFEVSSRPIGEKGTRCRYSTTKEITLQPLS
LDHVRLSTDPDGRSVISLRFNCSALADWTRIDLSLVPLYFNADAPLACAMHEAFTMNVARLWLRLPDEVD
RNALDGHFTALGFGEHDDLWPKGSSSFSGYQLLLEYFTFREKFMFTGLRGLESVAFPAELPWFEIDVVLT
ERWEHDFSFTEKHLRLNCVPVINLFPLESDPLTLNALQTEYLLRPMRVQDGHTEIYAVDSVMSSSQHTYV
PFSSFRHKGGMMRHDAPEYYYHTRVRRGPSGLHNTWLILGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSTRIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLRGTLALYEWTD
SEMNRRRLEAIIEVKHSETERFEQGYLVRGVQIEVTLNSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPNGERLEWQEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|386018361|ref|NC_017533.1|:170526-172280 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGGATGACTTAACCCTGCGTTACTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGCGAAGAGTTTG
CCCGCGCTCACCCCGAGCAGGCGGCAATGCTTAATCTTGATAAAGCGGGCGCGCGCGATCCCTACGTGGA
GCGTTTGTTCGAGGGCTTTGCCTTTCTGATGGGCCGTCTGCGTGAAAAGCTTGATGATGACCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCGCATTATCTGCGCACCATTCCGTCGATGTCAGTGGTGG
AGTTCACTCCTGACTGGCGCGAGATGAAAGAGCCGATGCGTATCGTCAAAGGTTTCGAGGTGAGCTCACG
GCCGATCGGTGAAAAGGGCACGCGCTGTCGGTACTCCACCACCAAAGAGATAACCCTTCAGCCGTTGTCG
CTGGATCACGTCCGCCTGTCAACGGATCCGGACGGGCGTTCGGTCATCAGCCTGCGCTTTAACTGCAGCG
CGCTGGCCGACTGGACGCGCATAGACCTCAGCCTCGTCCCGCTCTATTTCAATGCCGACGCGCCGTTGGC
CTGCGCCATGCACGAAGCCTTCACTATGAATGTGGCGCGACTGTGGCTGCGTTTGCCTGACGAAGTGGAC
CGCAACGCGCTCGACGGGCATTTTACCGCGCTGGGCTTTGGTGAACACGACGACCTGTGGCCCAAGGGCA
GCAGTAGTTTTAGCGGCTATCAGCTGCTGCTGGAGTACTTCACCTTTCGCGAAAAATTCATGTTCACAGG
TCTGCGCGGACTCGAGAGCGTGGCCTTTCCGGCGGAGCTTCCCTGGTTTGAGATCGACGTGGTACTGACA
GAACGCTGGGAGCATGACTTCAGCTTTACCGAAAAGCATCTGCGCCTGAACTGCGTGCCGGTGATTAATC
TGTTCCCGCTGGAATCTGACCCGCTGACGCTCAACGCCCTGCAGACCGAATACTTGCTGCGGCCGATGCG
CGTGCAGGATGGGCACACCGAGATTTACGCTGTGGATTCGGTGATGTCATCGAGCCAGCATACTTACGTG
CCGTTCTCCAGCTTCCGTCACAAAGGCGGGATGATGCGTCATGATGCACCGGAGTATTACTATCATACCC
GCGTTCGCCGTGGCCCGTCGGGGCTGCATAACACCTGGCTTATCCTCGGCGGTGAAGCATTCGATAACCA
CACAGTGCCGGAAGACGAAAGCCTGTCGTTGACGCTCACCGGCACCAACGGCCAACTGCCGCGTCGTGCA
TTACAAAGCACCGTGCTCGATACGGTGATGAAAACCACCTCGACCCGTATCGCCGTGCGTAACCTGTGTG
CGCCTACGCTGCCCTGTTATCCACCGGCGCAGGACCGTTTTCACTGGCGAGTGCTGAGCCACCTCGGCAG
CGGATTCCTGTCGATGATGGATAATGCCGACGTGCTGCGCGGTACCCTGGCGCTTTATGAATGGACCGAC
AGTGAGATGAACCGCCGTCGACTGGAAGCGATCATTGAAGTTAAGCACAGTGAAACCGAACGCTTTGAGC
AGGGTTACTTGGTGCGCGGTGTACAGATTGAAGTGACCCTGAACAGTCACGGTTTTGCCGGGCGTGGCGA
TATTTGTCTGTTTGGCGAAATGCTGAGTCGTTTCTTCGCGCTCTACACCGATATCTATCTGTTTAACCGT
CTGATCATCATCCTGCAACCAAACGGAGAACGTCTGGAATGGCAAGAGAAGCACAACCGCCGTATTCCCG
GCTGA