SecReT6
Protein ID: 386018516
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0157
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]172244..173329 [+]
Producthypothetical protein
NoteTssG
UniProt IDF2EZ97
KEGG IDpaj:PAJ_p0157
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.00E-76, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|386018516|ref|YP_005941122.1| hypothetical protein PAJ_p0157 [Pantoea ananatis AJ13355]
MAREAQPPYSRLTPRLEADLTRINFYRFCQLLEKRNPGRPLMGSTSHPADDPVRFAPHPGMGFPASELKA
VEYNEEDDSKPPLIRTTFMGMYGVDSPLPTAYLDDISQRREGHDVLQDFLDIFSHRILTQFYRIWRKYAY
PATFEPGGTDSISQSLLGLVGLGIPGTAEHIATPVSRFLSLLGVLQLPGKTQEGMQALVSLLAPDTRVQV
SPYCLRPVEVSQPLGFHGDNDFMLDGNTPLGDEAMDANSQLLIALSTDNEQESHGWKPDGLLYQDFLVML
RVYLGWRFKAKITLTTRTRLLAAPPLGEGPFWLGMNGVLGAEDEALPKDIPQTFTTELGYYTGLLPATPQ
QGNQRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|386018361|ref|NC_017533.1|:172244-173329 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGGCAAGAGAAGCACAACCGCCGTATTCCCGGCTGACCCCGCGACTGGAGGCTGACCTTACCCGGATTA
ACTTTTACCGCTTCTGCCAGTTGCTGGAGAAGCGTAATCCGGGCAGGCCGCTGATGGGGTCAACGAGCCA
CCCCGCGGACGATCCGGTGCGGTTTGCGCCGCATCCAGGGATGGGTTTTCCGGCCAGCGAACTGAAGGCT
GTCGAATATAACGAGGAGGATGACAGCAAGCCACCGCTGATCCGCACGACGTTTATGGGGATGTACGGTG
TCGATTCCCCTTTGCCGACGGCCTATCTCGATGACATCAGCCAGCGCCGGGAAGGGCATGACGTGCTGCA
GGACTTTCTGGATATCTTCAGCCACCGCATCCTGACGCAGTTTTACCGAATCTGGCGAAAGTACGCTTAC
CCGGCCACCTTTGAACCGGGCGGAACCGACAGCATTTCCCAGTCGTTGCTGGGTCTGGTGGGGCTGGGCA
TACCGGGCACCGCTGAGCATATCGCCACACCGGTATCCCGTTTTCTGTCGCTGCTTGGTGTGCTTCAGCT
GCCTGGTAAAACCCAGGAGGGGATGCAGGCACTGGTGAGCCTGCTGGCACCTGATACCAGGGTTCAGGTG
AGCCCGTATTGCCTGCGACCGGTAGAAGTCAGCCAGCCATTGGGCTTTCACGGTGATAACGATTTTATGC
TGGACGGCAACACGCCGCTTGGCGACGAGGCGATGGATGCCAACAGTCAACTGCTGATCGCCCTGTCTAC
CGATAACGAACAGGAGTCGCATGGTTGGAAACCGGACGGTCTGCTTTATCAAGACTTTCTGGTGATGCTG
CGTGTTTATCTCGGCTGGCGATTCAAGGCCAAAATTACCCTGACCACCCGCACCCGGCTGCTGGCCGCGC
CGCCCCTCGGCGAAGGCCCTTTCTGGCTTGGGATGAACGGCGTACTGGGCGCGGAAGACGAAGCTCTCCC
GAAGGATATTCCGCAAACCTTTACGACGGAACTGGGCTATTACACCGGCCTGCTGCCCGCGACACCACAA
CAAGGAAACCAACGTGTTACATACAAGTTTGACTAA