SecReT6
Protein ID: 386018517
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0158
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]173352..173852 [+]
Producthypothetical protein
NoteTssJ
UniProt IDF2EZ98
KEGG IDpaj:PAJ_p0158
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.40E-35, Aligned region: 4..156
Protein Sequence: 166 a.a.     [Download]
>gi|386018517|ref|YP_005941123.1| hypothetical protein PAJ_p0158 [Pantoea ananatis AJ13355]
MLAIALSGCGLTQSVSDGTKSAFSAVFYKKIKVLHLDFTAREALNTDARENNALSQSVVLRIYQLKDIKT
FDSSVYQQLLNEGETTLGGDLLATRDVVLKPGGDVSLNMAMEDDAKYVAVAGLFRDPDTVKNTWKLTIDR
EALDPDEARVIEAGSHYLKLLTPKDD
 
Nucleotide Sequence: 501 bp     [Download]
>gi|386018361|ref|NC_017533.1|:173352-173852 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGCTGGCAATCGCGCTTTCCGGTTGCGGTCTGACCCAAAGCGTCAGCGATGGGACCAAATCGGCCTTTA
GCGCGGTGTTTTATAAAAAGATTAAGGTGCTACATCTGGATTTCACCGCGCGCGAAGCCCTCAATACGGA
CGCGCGGGAGAACAACGCCTTGTCTCAATCGGTAGTGCTACGCATTTATCAGCTCAAAGACATCAAAACC
TTCGACAGCAGCGTCTATCAGCAATTGTTGAATGAGGGAGAAACGACGCTTGGGGGGGATCTACTTGCCA
CTCGTGATGTCGTGCTGAAGCCCGGTGGTGATGTCTCGCTGAATATGGCCATGGAAGACGACGCGAAATA
CGTGGCGGTTGCCGGGCTGTTTCGGGATCCGGATACGGTGAAAAATACCTGGAAGTTGACGATTGACCGC
GAAGCACTCGATCCTGACGAGGCGCGGGTGATTGAAGCCGGGAGTCATTATCTGAAGTTATTAACGCCAA
AGGATGACTAA