SecReT6
Protein ID: 386018518
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0159
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]173852..174307 [+]
Producthypothetical protein
NoteTssE
UniProt IDF2EZ99
KEGG IDpaj:PAJ_p0159
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-15, Aligned region: 31..117
Protein Sequence: 151 a.a.     [Download]
>gi|386018518|ref|YP_005941124.1| hypothetical protein PAJ_p0159 [Pantoea ananatis AJ13355]
MPQFHQSPSLYELLAGNFSGGLSLNQVSEENQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGM
PGTAHEMMGTLSAVLLKYEPRLKKITVVMLEQKVPGELRYTIDAELKGIGLVRYGTEFMPEGRVLLRHLK
QQQYLDTLTRL
 
Nucleotide Sequence: 456 bp     [Download]
>gi|386018361|ref|NC_017533.1|:173852-174307 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGCCTCAGTTTCATCAATCCCCTTCACTGTATGAGCTACTCGCCGGCAATTTCTCCGGTGGTCTGAGCC
TCAATCAGGTGAGTGAGGAAAACCAGGTTATCCTCTCAGTGCTGGATAACATGCAGCGAATCCTCAACTG
TCGCGCCGGAACGCTGGCGCATTTGCCGGATTACGGTTTGCCGGACATGACGAAAATCCTGCAAGGCATG
CCAGGTACGGCCCATGAAATGATGGGCACCTTATCTGCAGTTCTGCTCAAGTATGAGCCACGCCTGAAAA
AAATAACGGTTGTCATGCTGGAACAGAAAGTCCCCGGAGAGCTGCGCTATACCATTGACGCTGAACTCAA
AGGTATAGGACTGGTGCGCTACGGCACCGAGTTTATGCCAGAGGGCCGGGTCCTGTTGAGGCATCTTAAG
CAACAGCAGTATCTTGATACCTTAACCCGTCTGTGA