SecReT6
Protein ID: 386018519
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0160
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]174634..176025 [+]
Producthypothetical protein
NoteTssA
UniProt IDF2EZA0
KEGG IDpaj:PAJ_p0160
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.50E-52, Aligned region: 108..152
DUF3702 [PF12486], Evalue: 6.50E-52, Aligned region: 314..458
ImpA-rel_N [PF06812], Evalue: 5.90E-19, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 5.90E-19, Aligned region: 364..385
Protein Sequence: 463 a.a.     [Download]
>gi|386018519|ref|YP_005941125.1| hypothetical protein PAJ_p0160 [Pantoea ananatis AJ13355]
MNDITPRKIKTGGDPRTLPDYASLRNELSKLSHPARPDVNWLYVEKLCLSLFEQNGVELQTAAWYTFSRM
QLAGLFGLNEGLAILEALISHQWGALWPQPVHARMEILSSLSQRLQQRMRSLPLNYSDLGQLYRAEQRLT
VMVEVLQRLELKHLSQLDTLRTLMHNSAVPLENSDDTIPTTATSQPGFVLPAPLVKDAGISTGSQAGGPF
ENSSGPGSSVKWVYVAQPEHQANVDVLAAITAPVKKWKPFLAGMSTMLVISTAAVWGWHDLQRPDPLQTQ
LVASLAPLPATLTPEQVIRFRQQIPLPQDFIAQTQQQLTRLDQLSPGWNIDYSRQLVEQAQALWPEQAKP
LAQQWQQQRHAAALPAEQLNGWFQGMMSLQKLSDRLNGLDEQKGKYMTVSELKSVVFSTMQSFNQSIPVE
EQLRALSQHPAGEPLPAAARSQLEMHLKQLTARYAEITHQGSQ
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|386018361|ref|NC_017533.1|:174634-176025 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGAATGACATTACCCCACGTAAAATCAAAACCGGTGGCGACCCGCGCACGCTGCCGGATTATGCTTCCC
TGCGCAATGAACTGAGCAAGCTGTCACATCCGGCGCGGCCTGATGTGAACTGGCTCTATGTCGAAAAGCT
CTGCCTTTCACTGTTTGAGCAGAACGGTGTGGAGTTGCAGACCGCGGCCTGGTATACGTTTTCCCGTATG
CAACTTGCCGGATTATTCGGCCTCAATGAAGGTCTGGCGATACTGGAGGCGCTGATCAGCCATCAGTGGG
GCGCACTTTGGCCGCAGCCTGTTCACGCCCGAATGGAAATTCTCAGCAGTTTGAGCCAGCGCCTGCAGCA
ACGGATGCGCTCGCTCCCGCTGAATTACAGCGACCTCGGTCAGCTGTATCGGGCAGAGCAACGTCTCACC
GTTATGGTGGAGGTGCTGCAGCGTCTGGAGCTAAAACATCTCAGCCAGTTGGATACGTTGCGTACCCTGA
TGCACAACAGTGCTGTCCCGCTGGAAAACAGCGATGACACAATCCCGACAACGGCGACGAGTCAGCCAGG
TTTCGTGCTGCCTGCCCCCCTGGTGAAGGACGCGGGAATATCAACAGGTTCTCAGGCTGGCGGGCCATTT
GAAAACTCCTCAGGGCCAGGTAGCTCAGTGAAGTGGGTGTACGTTGCGCAGCCGGAACACCAGGCCAATG
TGGACGTACTGGCAGCAATAACGGCGCCGGTAAAAAAGTGGAAACCCTTTCTTGCCGGGATGAGTACCAT
GCTGGTAATAAGCACAGCCGCAGTGTGGGGCTGGCACGATCTTCAACGGCCTGACCCGTTACAGACTCAA
CTTGTCGCCTCTCTGGCGCCTTTACCTGCCACTCTCACGCCTGAACAGGTGATTAGGTTTCGTCAGCAGA
TTCCCCTGCCGCAGGACTTTATTGCACAAACGCAGCAACAACTGACCCGTCTGGACCAACTTTCGCCAGG
CTGGAATATTGACTACAGTCGACAACTTGTAGAGCAGGCTCAGGCGCTATGGCCAGAGCAGGCGAAACCG
CTGGCGCAGCAATGGCAGCAACAACGCCATGCTGCCGCTTTGCCAGCAGAGCAGCTAAATGGCTGGTTTC
AGGGAATGATGTCACTCCAAAAACTGAGTGACAGACTGAACGGACTTGATGAACAAAAGGGAAAATACAT
GACGGTCAGCGAGCTGAAATCAGTGGTTTTTTCCACTATGCAGTCCTTTAACCAATCCATACCGGTTGAA
GAGCAACTGCGGGCATTGTCACAACATCCTGCGGGCGAACCTTTACCTGCCGCTGCCCGGTCTCAACTGG
AAATGCACCTGAAGCAACTGACGGCCCGTTATGCTGAAATAACACACCAGGGCTCACAATAA