SecReT6
Protein ID: 386018747
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0107
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]127362..128243 [-]
Producthypothetical protein
NoteTssL
UniProt IDF2MV94
KEGG IDpsr:PSTAA_0107
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.50E-72, Aligned region: 61..266
Protein Sequence: 293 a.a.     [Download]
>gi|386018747|ref|YP_005936771.1| hypothetical protein PSTAA_0107 [Pseudomonas stutzeri DSM 4166]
MIKEMDYGQDDRTVIVNRAGEAPAQSPLTDFDTPPRFEQLEERMIYAARLRPAETFNISLNPLVAAASPL
LSEVVRFKHSLESEDLQALHGQLSSAIKLFEHRALHDGAESSQVMAARYVLCTVLDEAVVTTPWGNESEW
SQMSLLSSFHNETFGGEKFFQLLERLSRNPVKHLPMLELMYLCLSLGFEGKYRVLPRGMLELEAVRDSLY
RQIRQMRGDIPRELSPHWEGLKDTRRRLVRIVPWWMVALFTLVCLGVIYGGFAWVLGEQREAVLQPYRSL
DMDAGGSTFSGMK
 
Nucleotide Sequence: 882 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c128243-127362 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGATCAAGGAAATGGATTACGGACAGGACGACCGCACGGTCATCGTCAATCGAGCAGGAGAGGCCCCGG
CGCAGAGCCCGCTGACCGACTTCGACACCCCGCCGCGCTTCGAGCAGCTGGAGGAGCGGATGATCTACGC
GGCGCGCCTGCGCCCGGCGGAAACCTTCAACATCAGCCTCAACCCGCTGGTGGCCGCCGCCTCGCCGCTG
CTGTCGGAAGTGGTGCGCTTCAAGCACAGCCTGGAAAGCGAGGACCTGCAGGCCCTGCACGGCCAGTTGA
GCAGCGCGATCAAGCTGTTCGAGCATCGCGCTCTGCATGACGGTGCCGAAAGCAGCCAGGTGATGGCGGC
GCGCTACGTGCTCTGCACCGTGCTCGACGAGGCCGTGGTGACCACGCCCTGGGGCAACGAAAGCGAATGG
TCGCAGATGAGCCTACTGTCCTCCTTCCACAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGCTGCTCG
AGCGGCTGTCGCGCAATCCGGTCAAGCACCTGCCGATGCTCGAGCTGATGTACCTCTGCCTGTCGCTCGG
CTTCGAGGGCAAGTATCGCGTGCTACCGCGCGGCATGCTCGAGCTGGAAGCGGTACGCGACAGCCTCTAC
CGACAGATTCGCCAGATGCGCGGCGATATACCGCGCGAGCTGTCGCCGCACTGGGAAGGCCTCAAGGACA
CCCGCCGGCGTCTGGTGCGCATCGTGCCCTGGTGGATGGTGGCGCTGTTTACCCTGGTCTGTCTCGGGGT
GATTTACGGCGGCTTCGCCTGGGTGCTCGGCGAACAACGCGAGGCCGTGCTGCAACCCTACCGCTCGCTG
GACATGGATGCCGGCGGTTCCACCTTTTCAGGGATGAAATGA