SecReT6
Protein ID: 386018748
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0108
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]128249..129580 [-]
Producthypothetical protein
NoteTssK
UniProt IDF2MV95
KEGG IDpsr:PSTAA_0108
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-147, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|386018748|ref|YP_005936772.1| hypothetical protein PSTAA_0108 [Pseudomonas stutzeri DSM 4166]
MSLHKVVWQEGMLLRPQHFQQSDRYYDHQLKARTQKLSSYAWGFFNLEIDRQFLNMGKLVLSQASGILPD
GTLFELGSEREPLALDIPPNTGSTPVYLALPLVTGNHIETRRPEQKDVLARYTAHELDVADSNAGDSSTS
QVSTGLPDFRLLLGEQQSDQAYVKLQLCEVLDTTPDGVISLDPEFIPTYVNFQASAYLLSCLKEVISMLA
HRGDTLAERISATGKVGGAEVGDFMMLQLINRHEPVLRHYLGVEQVHPEQIYRDLLGLLGGLATFSSESK
RPRLDGRYQHSDQGASFRKLMDAIRQVLSMVLEQHAIELLLQQRQYGIQVSPLHDHKLLGTASFVLAASA
QCDSETLRTRLPAHLKIGPVERIRQLVNLHLPGIRLKPLPVAPRQIPFHAGKTYFALELSAEDQAQLERS
GGFAFHVSGDFAGLELKFWAVRD
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c129580-128249 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGAGCCTGCACAAGGTTGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACTTCCAGCAGAGCGATC
GATACTACGATCACCAACTCAAGGCGCGCACCCAGAAGCTGAGCAGCTATGCCTGGGGATTCTTCAATTT
GGAGATCGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGCTCAGCCAGGCCAGCGGCATCCTCCCGGAC
GGGACCCTGTTCGAGCTGGGCAGCGAGCGCGAGCCTCTGGCTCTGGACATCCCGCCGAATACCGGCAGCA
CTCCGGTCTATCTCGCGCTGCCGCTGGTCACCGGCAACCACATCGAAACCCGCCGGCCCGAGCAGAAGGA
CGTGCTGGCGCGCTATACCGCCCACGAACTGGACGTCGCCGACTCCAATGCCGGCGACAGCAGCACGAGC
CAGGTCAGCACCGGTCTGCCAGACTTCCGCCTGCTGCTGGGCGAGCAGCAGAGCGACCAGGCCTACGTGA
AACTGCAGCTGTGTGAGGTGCTGGACACCACGCCGGACGGGGTCATCAGCCTCGACCCCGAGTTCATCCC
CACCTATGTCAACTTCCAGGCCTCCGCCTATCTGCTGTCCTGCCTGAAGGAAGTGATCAGCATGCTCGCC
CACCGCGGCGATACCCTTGCCGAGCGAATCAGCGCCACCGGCAAGGTGGGTGGCGCCGAGGTCGGCGACT
TCATGATGCTGCAGCTGATCAACCGTCACGAACCGGTGCTGCGCCACTACCTGGGCGTGGAGCAGGTGCA
TCCGGAGCAGATCTACCGGGATCTGCTTGGCCTGCTCGGCGGGCTGGCGACCTTCTCCAGCGAGAGCAAG
CGCCCGCGCCTGGATGGCCGTTACCAGCACAGTGATCAGGGCGCGAGCTTCCGCAAGCTGATGGACGCGA
TCCGCCAGGTATTGTCGATGGTGCTCGAGCAGCACGCCATCGAGCTGCTGCTGCAGCAGCGTCAGTACGG
CATCCAGGTATCGCCGCTGCATGACCACAAGCTGCTAGGCACGGCGTCCTTCGTGCTCGCCGCCAGCGCC
CAGTGCGATTCGGAAACCCTGCGCACACGGCTGCCGGCGCACCTGAAGATCGGCCCGGTGGAACGCATCC
GTCAGCTGGTCAACCTGCATCTGCCGGGCATCCGCCTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
CTTCCACGCCGGCAAAACCTATTTCGCCCTGGAGCTCAGTGCCGAGGACCAGGCGCAGCTGGAGCGTTCC
GGTGGCTTTGCCTTCCATGTGTCCGGTGACTTCGCCGGGCTCGAACTGAAATTCTGGGCGGTCAGGGACT
GA