SecReT6
Protein ID: 386018749
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0109
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]129583..130065 [-]
Producthypothetical protein
NoteTssJ
UniProt IDF2MV96
KEGG IDpsr:PSTAA_0109
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-40, Aligned region: 13..149
Protein Sequence: 160 a.a.     [Download]
>gi|386018749|ref|YP_005936773.1| hypothetical protein PSTAA_0109 [Pseudomonas stutzeri DSM 4166]
MPRRITLAMLASLLVLGGCSALSPYSKLTKLDLELHGSDRLNPDLNGRPSPIVLRLLELKHPVAFENGDF
FALYQRPKEALAPDLVTSEELELRPGESRELKLSVQDGSRYVGVLAAYRDLPEASWRYVIAVPPQERTRI
ALSLDERGIALFDPLAEEGK
 
Nucleotide Sequence: 483 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c130065-129583 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGCCTCGTCGCATCACCCTGGCCATGCTGGCCTCGCTGCTCGTGCTGGGCGGCTGCTCGGCACTGTCGC
CGTACTCCAAGCTGACCAAGCTGGACCTCGAGCTGCACGGCAGCGACCGTCTCAACCCCGACCTCAACGG
CCGGCCTTCGCCGATCGTGCTGCGCCTGCTGGAGCTCAAGCATCCGGTGGCGTTCGAAAACGGCGACTTC
TTCGCACTCTACCAGCGGCCCAAGGAAGCACTGGCGCCGGACCTGGTGACCTCCGAGGAACTGGAACTGC
GTCCCGGCGAAAGCCGTGAGCTGAAGCTCTCCGTGCAGGACGGCAGCCGCTACGTCGGCGTGCTGGCCGC
CTACCGCGACCTGCCGGAAGCCAGCTGGCGCTACGTCATCGCCGTGCCGCCGCAAGAGCGCACCCGCATC
GCCCTGAGCCTGGACGAGCGCGGCATCGCGCTGTTCGACCCGCTCGCCGAAGAAGGAAAATAA