SecReT6
Protein ID: 386018750
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0110
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]130070..131266 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDF2MV97
KEGG IDpsr:PSTAA_0110
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-12, Aligned region: 29..97
Protein Sequence: 398 a.a.     [Download]
>gi|386018750|ref|YP_005936774.1| FHA domain-containing protein [Pseudomonas stutzeri DSM 4166]
MELVFDMVGAQQFVPGLLTTKTFKQAGGVIGRAEGCDWVIPDRKRVLSGRHAVISYRDGAFFLTDTSSNG
IQLKDSGASLVKGQPQRIEHGSVYCLGDFEIRARLIQDPARFEGDIGRPQPAGTIIPDDAFLDLDPLVAM
DQQERIYAEVDDLDLTLVAPQRQAQQRDYARIDTESLPLPELVMPPTAAEPKREPEPERLPPGFWERFGE
ALGIDLGGMDEDQRQALALNAARLLKQSVAGLQQSLRTRSELKNELRLALTTVQSAGNNPLKHSADASEA
LNALLRGGKPGQLSAEQAVGRAFRDLQAHQVALLAASRAAVHAMFEQLAPEQLALRFEREGRKPLLATAG
SRWRAYRRLHHSLGQDADWSERLFARDFAKTYEEQVRLIATLDSTHQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c131266-130070 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGGAACTGGTCTTCGATATGGTGGGCGCCCAGCAATTCGTGCCCGGGCTGCTGACCACCAAAACCTTCA
AACAGGCCGGCGGAGTGATCGGCCGCGCAGAGGGCTGCGATTGGGTGATCCCCGACCGCAAGCGCGTCCT
CTCCGGACGTCATGCAGTGATCAGCTACCGCGACGGCGCCTTCTTTCTCACCGACACCAGCAGCAACGGC
ATCCAGCTCAAGGACAGCGGCGCCAGCCTGGTCAAAGGCCAGCCGCAACGCATCGAGCATGGCAGCGTCT
ACTGCCTGGGCGACTTCGAGATCCGCGCCCGGCTGATCCAGGACCCGGCGCGGTTCGAAGGCGACATTGG
CCGCCCGCAACCGGCCGGCACCATCATCCCCGACGATGCCTTCCTCGACCTCGATCCCCTGGTCGCGATG
GATCAACAGGAGCGCATCTACGCCGAAGTCGACGACCTCGACCTGACGCTGGTGGCACCACAACGCCAGG
CCCAGCAGCGCGACTACGCCCGCATCGACACCGAAAGCCTGCCGCTGCCGGAACTGGTCATGCCACCGAC
TGCAGCCGAACCCAAGCGCGAACCGGAGCCTGAACGTCTGCCACCCGGCTTCTGGGAGCGCTTCGGCGAG
GCACTGGGCATCGATCTCGGGGGGATGGATGAAGACCAGCGGCAGGCGCTGGCACTGAATGCTGCCCGCC
TGCTCAAGCAGAGCGTGGCGGGCCTACAGCAGAGCCTGCGCACCCGCAGCGAGCTGAAGAACGAGCTGCG
CCTGGCGTTGACCACCGTGCAGAGCGCCGGCAACAACCCGCTCAAGCACAGCGCCGATGCGAGCGAGGCC
CTGAACGCCCTGCTGCGCGGTGGCAAACCTGGCCAGCTCAGCGCCGAACAGGCCGTCGGCCGCGCCTTTC
GTGATCTGCAGGCGCATCAGGTGGCACTGCTGGCGGCCAGCCGCGCCGCCGTTCACGCGATGTTCGAACA
GCTGGCGCCGGAGCAGCTGGCGCTGCGCTTCGAACGCGAAGGCCGCAAACCCCTGCTCGCCACCGCCGGC
AGTCGCTGGCGCGCCTATCGCCGCCTGCATCACAGCCTCGGCCAGGATGCCGACTGGAGCGAACGCCTGT
TCGCCCGCGACTTCGCGAAGACCTATGAGGAGCAGGTGCGCCTGATCGCCACGCTCGATTCAACCCATCA
AGGATGA