SecReT6
Protein ID: 386034512
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09750
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2049854..2050345 [+]
Producthypothetical protein
NoteTssB
UniProt IDG0GMR1
KEGG IDkpo:KPN2242_09750
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.20E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|386034512|ref|YP_005954425.1| hypothetical protein KPN2242_09750 [Klebsiella pneumoniae KCTC 2242]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVVRQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2049854-2050345 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAAAAGAAGGTCGAACTGCCGCTGAAGCTGCTTACCATTGGCGATTTTAGTCATGGGAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGC
GTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGTCCGGCAAATTCCGCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA