SecReT6
Protein ID: 386034513
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09755
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2050388..2051932 [+]
Producthypothetical protein
NoteTssC
UniProt IDG0GMR2
KEGG IDkpo:KPN2242_09755
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-171, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|386034513|ref|YP_005954426.1| hypothetical protein KPN2242_09755 [Klebsiella pneumoniae KCTC 2242]
MSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAERLTAAMQVFM
DRIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTEIL
DVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAAHM
PFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2050388-2051932 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAACAGCGCGGGCGAGG
GCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCACCCCGGCGTCTCGCCTCGGGGATATCAACGACTT
TCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAGCGTCTCACCGCGGCGATGCAGGTGTTTATG
GATCGCATCCGTCAGTCCGGCCAGCGGGTGGAAAAGCTCGACAAAACGCTGATCGACCACCATATCGCCG
AGCTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATC
CCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTC
GACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCCTGTACT
GGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGA
GTTCGACGCCAGCCCGCAGGATGTGGCGCTGCTGCGCAATATCTCCCGGGTTTCTGCGGCCGCCCATATG
CCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCATTAAGG
ATATCGGCAACTACTTCGATCGCGCGGAATATATTCGCTGGAAGGCGTTTCGTGAAACCGACGATGCCCG
CTACATCGGCCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGCCCGGACACCGTGCCGGTGCGC
AGCTTCAACTATGTCGAGCAGGTGAAGGGCCCGGACCACGAAAAATATCTCTGGACCAGCGCGGCGTTCT
CCTTCGCTTCCAATATGGTGAAGAGCTTTGTTAACAACGGCTGGTGCGTGCAAATTCGCGGTCCGCAGGC
GGGCGGCGCGGTGAAAGATTTGCCTATCCATCTGTACGATCTGGGCACCGGCAACCAGGTGAAGATCCCT
TCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGC
CGACGCCACCGCCAACAGCCGTATCAACGCGCGTCTGCCTTATATCTTCCTGCTGTCGCGCATCGCGCAC
TACCTGAAGATGATCCAGCGCGAGAATATCGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGGAGCTGA
ACACCTGGGTGCGGAGCCTGGTGACCGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCT
GCGCGATGCCAGCGTGGTGGTGGAAGATATCGAGGATAACCCGGGCTTCTTCCGAGTGAAGCTGTACGCG
GTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGGCGAAGG
CGTAG