SecReT6
Protein ID: 386034514
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09760
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2051945..2053285 [+]
Producthypothetical protein
NoteTssK
UniProt IDG0GMR3
KEGG IDkpo:KPN2242_09760
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-136, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|386034514|ref|YP_005954427.1| hypothetical protein KPN2242_09760 [Klebsiella pneumoniae KCTC 2242]
MKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQD
GTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDTR
QIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLVQLRAR
LTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSLT
HQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLSV
RSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2051945-2053285 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGGCTG
CGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGAGGC
GACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAGGAT
GGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGTCCGGCG
AGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGAGGT
GGCCGAAAGGCCGGTGCGCTTCCGGCAGCGCTGGCGCGATGTCCGTAACCAGTTTGGGGATGATACCCGG
CAGATTGCCGTCATACAGCCGGAGCTGATCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGACCT
GTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCCGCT
GCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCGTCCAGCTCCGGGCTCGT
CTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTAGCCGATGTCT
CTCTGTTCTGGTTGCTGAATGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTTACCGGCA
AAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTCACC
CATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGTTGAACGCGGTTTTTCCGCCGCTGTTTGATT
TACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCGGGTGGTGGCGATTGCGCTGGAGCATGATGTCCG
GCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCGGTT
CGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGGATC
ATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGCGGC
GATCCCGCTACGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCGACGGAAATGCTG
CAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTGGGTGAGCCTGAACTTGAACTTTTTGCGGTAC
TACGAACGTGA