SecReT6
Protein ID: 386034517
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09775
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2055679..2056170 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDG0GMR6
KEGG IDkpo:KPN2242_09775
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386034517|ref|YP_005954430.1| type VI secretion system effector [Klebsiella pneumoniae KCTC 2242]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2055679-2056170 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCTCAGGAGCATAACCTGTATATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATTCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCC
TACCTGTACAAGGCGGTGACCACCGGTCAGACCCTGAAGTCCGCCGAGTTTAAGTGGTACCGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATACCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCCGCCTACGAGAAGCACAACCATCTGGAACAGATAGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA