SecReT6
Protein ID: 386034519
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09785
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2059083..2061461 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG0GMR8
KEGG IDkpo:KPN2242_09785
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-66, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 2.20E-42, Aligned region: 613..759
T6SS_Vgr [PF13296], Evalue: 2.70E-34, Aligned region: 489..591
T6SS_Vgr [PF13296], Evalue: 2.70E-34, Aligned region: 628..677
Phage_base_V [PF04717], Evalue: 9.70E-17, Aligned region: 339..358
Phage_base_V [PF04717], Evalue: 9.70E-17, Aligned region: 389..482
Protein Sequence: 792 a.a.     [Download]
>gi|386034519|ref|YP_005954432.1| Rhs element Vgr protein [Klebsiella pneumoniae KCTC 2242]
MSSVKSLLFSHNHHLLSVKGCEAGLDVLTFEGDEALSQPFRYRIEFTSADHAISKEMMLMKSASLTLQAP
VAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRE
RHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKG
LTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDN
YLTAGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFADGVLVTA
MHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDR
ARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRN
VLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAEKQPRGEGFELRTDSWGAIRAQKGIFISA
DGQAQAQGQVLAMEPAVSLLKGAVNQVTEWGSITQTHHNVVPDTGPLSALTAGASDLKQPTLLMSAPQGI
AAVTPETTLLHSGNGLYLQSLGEVNITTAQRCSLNASQAISLLAQQEGMRLVSAKGPLEVESHGDILSLT
ALKDITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGEVQIHGPGVISLKGQHDLQGPVSEAFPLPELPA
SVCKECLKKAQALAQGFVPREA
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2059083-2061461 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGAGTAGCGTGAAATCGTTGTTGTTCAGCCACAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCG
GGCTTGATGTGCTGACCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCAC
CAGCGCAGACCATGCCATCAGCAAAGAGATGATGCTGATGAAGTCAGCCTCCCTGACGCTGCAGGCGCCG
GTGGCTCAGGGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGTGTGGTGACGGGGTTTG
AACGGCTCAGTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTTAA
CCGCTCGCACCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAG
CGCCACGGCCTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGACGCGAGCAGGTGA
TGCAGTACGGCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGAGGTGGGGATCTGGTTTCGCTT
TACCGCCGACACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGG
CTGACGTTGCCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCAT
GCCGCCACCGCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACAT
GAACGCGCAGGTGGATGTCACTCGCGGGGAGACCACCACCTTTGGTGAGGCTTACCACTGGGGAGATAAC
TACCTGACCGCGGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGGCTTC
GCCATGAGCGTTATCTGAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGG
ACAGGTGCTGAAGGTCACCGGCGGAGAGGAGGTGGCCGGGGAGTTTGCTGATGGCGTGCTCGTCACGGCG
ATGCACAGCCACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACG
TCGGCTACCGGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCAC
CCGGGAAAACGACACCTACGGGCATATCGATAAACACGGACGCTACCGGGTGAATATGCTGTTTGACCGG
GCGCGCTGGGAAACCGGGTTCGAGAGCCTGTGGGTCCGCCAGTCGCGGCCGTATGCCGGAGACACTTACG
GCCTGCACCTGCCGCTGCTGGCGGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCCGACCGGCC
GTATATCGCGGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATTCGCAATGACAAACGTAAC
GTCCTGCGCACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCGGGAAAGAACATATCAAGGTCA
GCACGGAGTACGGCGGTAAAAGCCAGCTCAATCTCGGGCATCTGGTGGATGCTGAAAAGCAGCCGCGCGG
CGAAGGCTTTGAGCTGAGAACCGACAGTTGGGGAGCTATCCGGGCACAGAAGGGTATTTTTATCAGCGCG
GACGGACAGGCGCAGGCTCAGGGGCAGGTGCTGGCGATGGAGCCGGCGGTCAGTTTGCTGAAAGGTGCGG
TGAATCAGGTCACGGAATGGGGAAGTATTACGCAAACCCATCACAATGTTGTCCCAGACACCGGCCCATT
AAGCGCACTGACCGCAGGCGCCAGCGATCTTAAACAGCCGACATTGCTGATGTCGGCCCCGCAGGGGATT
GCCGCAGTCACGCCGGAAACGACCCTACTACACAGCGGTAACGGGCTGTATCTGCAGAGCCTGGGAGAGG
TCAACATCACCACGGCACAGCGCTGTTCACTGAATGCCAGCCAGGCTATTTCACTGCTGGCGCAACAGGA
AGGAATGCGGCTGGTCTCCGCCAAAGGCCCGTTGGAAGTAGAGTCGCACGGCGATATTCTGTCGCTGACC
GCGCTAAAAGATATCACCGTCCAGTCAACCCAGGGGCATCTGCAGTTGACGGCTAAAAATGGCATCACCC
TGGGTTGCGGCGGCGCATATATCCGTCTTACCCCGCAGGGAGAGGTACAGATCCACGGACCGGGGGTGAT
TAGCCTTAAGGGGCAGCATGATTTGCAGGGGCCGGTCAGCGAGGCGTTTCCCTTGCCTGAGCTACCGGCA
TCGGTGTGTAAAGAGTGCCTTAAAAAAGCCCAGGCGCTGGCGCAGGGCTTCGTGCCGCGGGAGGCATGA