SecReT6
Protein ID: 386034529
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09835
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2072955..2074709 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDG0GMS8
KEGG IDkpo:KPN2242_09835
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.80E-179, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|386034529|ref|YP_005954442.1| type VI secretion protein [Klebsiella pneumoniae KCTC 2242]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKESMTIGKGFEVLSRPIGEKGTRCRYTTTKAIALQPLS
LERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPDVVD
RRPLDGYFSALGFGEDDGLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVKHRATECFAQGHLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2072955-2074709 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGACGATTTAACCTTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGCAATGCTCAATCTCGACAAAGCGGGCGCCCGCGACCCCTTTGTCGA
GCGCCTGTTTGAAGGTTTTGCCTTCCTGATGGGCCGCATGCGCGAGAAACTCGATGACGATCTGCCTGAG
CTGACCGAAGGCGTGGTCAGTCTGCTGTGGCCACATTATTTACGTACCATTCCCTCGATGTCGGTCGTGG
AGTTCACCCCCGACTGGCCGGAAATGAAAGAATCGATGACGATAGGCAAAGGTTTTGAAGTGCTTTCCCG
GCCGATCGGTGAAAAGGGCACGCGCTGCCGGTACACCACCACCAAAGCGATCGCTCTGCAGCCGTTATCC
CTGGAGCGCGTCCAGCTGGCCACCGATACGGATGGCCGGTCGGTGATCACGCTGCGCTTTACCTGCAGCC
AGCTGACGGACTGGCGCCGGGTCGATCTCAGTCATATCCCGCTGTACTGCAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGAGGCCTTTACCCTCAATGTGGCCCGGATGTGGCTGCGCATGCCCGATGTGGTGGAC
AGAAGGCCGCTGGACGGGTATTTCAGCGCGCTGGGTTTTGGCGAGGATGACGGCCTCTGGCCTGAAGATG
GCCGCAGTTTTCGCGGTTATCAGCTGCTGCTGGAGTATTTTACCTTCCGCGAAAAGTTCATGTTCATCGA
TCTGCGCGGGCTGGAGACGGTGGCTTTTCCGGCCGGACTGGCGTGGTTTGAAATCGACGTCGTGCTGGCG
GAACGCTGGGAACATGACTTCCGCTTCAGCGAAAAGCAGCTGCGCCTGCACTGCGTGCCAGTGATCAACC
TGTTTCCGCTGGAGTCCGATCCGCTGACCATCAATTCCCTGCAGACCGAATACCCGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCGAAATTTACACCGTCGATTCCGTGATCTCCTCACACCAGCAGGTTTACGCG
CCGTTCTCAAGTTTTCGCCACAAAGGCGGCATGATGCGTCATGACGCGGCGGACTATTACTATCATACCC
GGGTGCGCCGTGGCCCCTCCGGGCTGTACAACACCTGGCTTATCGTCGGCGGAGAAGCCTTTGATAATCA
TACCGTACCGGAAGATGAAAGCCTGTCGCTGACCCTCACCGGAACCAACGGCCAGCTGCCGCGTCGCGCG
CTGCAGAGCACCGTGCTCGATACGGTGATGAAAACCACTTCCGCCAGTATTGCAGTGCGTAACCTCTGCG
CGCCGACGCTGCCGTGCTATCCCCCCGCCCAGGACCGTTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAGTTTTCTTTCCCTGATGGATAACGCGGAGGTCCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAATCGTCGGCGTCTGGAAGCCATCCTCGACGTGAAGCACCGCGCAACAGAGTGCTTTGCAC
AGGGCCATCTGGTGCGCGGTGTGCAGATTGAAGTCACCCTCGACAGTCACGGCTTTGCCGGACGAGGCGA
TATATGCCTGTTTGGCGAGATGCTTAGCCGCTTCTTCGCGCTCTACACCGACATCTACTTGTTCAACCGC
CTGATTATCATTCTGCAACCAACCGGAGAACGACTGGAATGGGAAGAGAAGCACAGCCGCCGCATTCCCG
GCTGA