SecReT6
Protein ID: 386034530
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09840
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2074673..2075758 [+]
Producthypothetical protein
NoteTssG
UniProt IDG0GMS9
KEGG IDkpo:KPN2242_09840
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.30E-73, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|386034530|ref|YP_005954443.1| hypothetical protein KPN2242_09840 [Klebsiella pneumoniae KCTC 2242]
MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPGMGFPASELKA
VEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLLDIFSHRIMTQFYRIWRKYSW
PATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRV
SPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILL
RVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGAGEGESEDDIPQTFTTQLGTYTGLQPATFL
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2074673-2075758 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGGAAGAGAAGCACAGCCGCCGCATTCCCGGCTGACCCCGCGACTGGAGGCCGACCTGCCGCGGATCA
ATTTTTACCGCTTCTGCCAGCTTCTGGAAAAACGGCGTCCCGGCCAACCGCTGATGGGGGGAACCAGCCA
TCCGGCTGACGATCCGGTGCGTTTTTACCCGCATCCGGGAATGGGATTTCCCGCCAGCGAACTGAAAGCC
GTGGAATACGATGAGGCCGATGACAGCAGGCCGCCGGTCATTCGCACCACCTTTATGGGGTTGTACGGTG
TCGATTCGCCGCTCCCGACGGCATATCTCGATGATATCGCCCAGCACAGGGAAGGGCATGAAGCGCTGCA
GGGCTTACTGGATATCTTCAGCCACCGGATCATGACGCAGTTTTACCGCATCTGGCGGAAATACTCCTGG
CCCGCCACCTTTGAGCCCGGCGGCACCGATCGTCTCTCGCAGTCGCTACTGGGCCTGGCGGGGCTGGGCA
TCCCCGGCACGACGCAGCATATCGCCTCGCCGGCGTCGCGCTTTCTGGCGCTAACCGGCGTGCTGCGTCA
GCCGGGCAAAACCCAGCAGGGGATCCAGGCGCTGGTCACCCTGCTGGCCCCGGAGACCACCGTCAGGGTG
AGCCCGTACAGCCTGCGTCCGGTGGCGATCAGCCAGCCGCTGGGGTTTTACGGCGATGACGACTTCTTCC
TGGACGGCAATACGCCGCTGGGTGACGAAGCGATGGATGCCAGCAGCCAGCTCCTCGTCGCCCTTACCAC
CGACAATCCCGCGGAGGCGCAGGGCTGGAAGCCTGACGGCCCGCTGTTTCGGGACTTTCTCATCCTGCTG
CGGGTATACCTCGGCTGGCGATTCCGGGCCAACATCACCCTGACCGCGCCGACCCGACTGCTGGCTGTCC
CGCCGCTGGGGGACGAGCCGTTCTGGCTCGGTATGAACGGCGTGCTGGGCGCGGGTGAGGGCGAGAGTGA
GGACGATATTCCTCAGACCTTTACCACCCAGCTGGGTACCTATACGGGCCTGCAGCCTGCCACCTTTCTA
CAAGGAAACCGACGTGTTACGTATAAGTTTGACTAA