SecReT6
Protein ID: 386034531
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09845
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2075751..2076278 [+]
Producthypothetical protein
NoteTssJ
UniProt IDG0GMT0
KEGG IDkpo:KPN2242_09845
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-35, Aligned region: 12..166
Protein Sequence: 175 a.a.     [Download]
>gi|386034531|ref|YP_005954444.1| hypothetical protein KPN2242_09845 [Klebsiella pneumoniae KCTC 2242]
MTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSEPVVVR
IYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRHPDTQR
NTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK
 
Nucleotide Sequence: 528 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2075751-2076278 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
TTGACTAAAACCGCCTGTCTGCTGCCCCTGCTTGCGCTTTGCCTGAGCGGATGCGGACTCACCCAGCGCG
TCTCGGAGGGAACAAAGTCTGCCTTCAACGCCGTTTTTTATAAGAAAATTAATACGCTGCATCTGGACTT
TACCGCGCGCGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAACCGGTGGTGGTGCGC
ATCTATCAGCTTAAAGATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGCTGGAGGAGGGGGATA
TTCTGCTCGCCGCCGATCTCCTCGCCAGTCGCGATGTGGTGATCGGTCCCGGAGGGGACGCCAGTCTCAA
TATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGGTTGTCGGCCTGTTCCGCCATCCGGACACACAAAGA
AATACCTGGAAGCAGGTGCTGGCGCGTGAGGAATTGGATCCGGACAAGCCGCGCATTTTCACCGCCGAAC
ACAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA