SecReT6
Protein ID: 386035390
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14240
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2959087..2960502 [-]
Producthypothetical protein
NoteTssA
UniProt IDG0GHR4
KEGG IDkpo:KPN2242_14240
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.60E-51, Aligned region: 36..61
DUF3702 [PF12486], Evalue: 1.60E-51, Aligned region: 90..178
DUF3702 [PF12486], Evalue: 1.60E-51, Aligned region: 303..447
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 324..340
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 356..374
Protein Sequence: 471 a.a.     [Download]
>gi|386035390|ref|YP_005955303.1| hypothetical protein KPN2242_14240 [Klebsiella pneumoniae KCTC 2242]
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLAR
ARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSL
QSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAAKVEPV
PDLKRRPKAEPLAPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSA
GALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLVELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2960502-2959087 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGATGACAACACACCACGACCGTCACTATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGG
CCCTGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCA
GCTTGCCCGCGGGCTGTTGGAGCATCACGGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGC
GCCCGGCTGGGCGGGGTGGCAGGGATCAATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGG
GGAAAAACCTGTGGCCACAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCG
GCAGGTGATCCGTACCCTGAATCTTACCCCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTG
CAAAGCTTCGACGCAGTGCTCCAGCGCCTTGAGATCGCTCCTGAAAACCAGCTGAGCGACCTGCGGGCGC
TACTGCACAGCACGGCAACTCGCTTCGAGAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGT
GGCGGTGTCTGACGCGGAACTTCCTGGCACTCTGGTCAGCGAAGAGGATGCGGCGAAGGTTGAGCCAGTG
CCAGACCTAAAACGTAGACCAAAGGCTGAACCGCTGGCTCCGCCTTCACCTGCAAAGCGGCCCGCGCCGG
TGGCGGCGTCTACTCCGGCAGCCGCGCCGCGCTGGAAGCCGTTTATCGCCGGAATGGTTACCATGCTGGC
GGTAACGGGTATCGCCGTCGGCGGATGGCTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCGGTCACC
CAAAATGCCGGACCGATACCGGGCCTGCCGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGC
AGCGCCAGCTTGGCGAGCTTGCCCGCCTGGCGCCGGACTGGGCGGTCAGCTACGGCGACCAGCTGGTCCA
CCAGGCCCTTATCCGCTGGCCGGATCAGGCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGTGCT
GGCGCATTGCCCGCGGAAAATCTTACCGGCTGGTCGGAGGGCATGCAGCAGCTGCAGCGGCTCGCCGACC
AGCTCAATGCCCTCGACGAGCAGAAGGGGAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGC
CATCACACAGTCGTTTAACCGCGCTGTTCCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTT
GATCAACCCTGGCCAGCCGCGCGGGGAAGCCTCGTGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATG
CCCTGCTGAAGCGAAAACAGCCGGCGTCGCCGACCGCTGCGCTCCCCGCAACCGGTGAGCCCTCGGTGAG
TGAGGCGGTGAAATAA