SecReT6
Protein ID: 386035391
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14245
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2960522..2960965 [-]
Producthypothetical protein
NoteTssE
UniProt IDG0GHR5
KEGG IDkpo:KPN2242_14245
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|386035391|ref|YP_005955304.1| hypothetical protein KPN2242_14245 [Klebsiella pneumoniae KCTC 2242]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2960965-2960522 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATACTGTCA
GCGAAACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGCCGGAAC
GCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTGTCCTCCAGGGGATGCCAGCGTCGGCG
CATCAGCTGATGAGCACGTTGTCGGCGGTGTTGCTGAAATACGAACCGCGCCTGCAGCGGATCGCGGTGG
TGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATATTGGCCT
GGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGTCAGCAGTAC
CTTGACGCCCGCTCCGCCCTCTAA