SecReT6
Protein ID: 386035392
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14250
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2960968..2961504 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG0GHR6
KEGG IDkpo:KPN2242_14250
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-37, Aligned region: 19..169
Protein Sequence: 178 a.a.     [Download]
>gi|386035392|ref|YP_005955305.1| hypothetical protein KPN2242_14250 [Klebsiella pneumoniae KCTC 2242]
MAITAVKPSARLLAFLMVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLAT
VVRIYQLKNRQAFDNTDYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFIDPD
LTQNSWRLVLTRDELDPARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2961504-2960968 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGCGATTACCGCAGTTAAACCCTCCGCCAGGTTGCTGGCATTCCTCATGGTTACCGTCTTAACCGGCT
GCGGCCTGACGCAGACCGTGAAAGACGGCGCCGTTTCCGTGACCCAGTCCATTTTTTACCCCCAGGTGAA
AACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGCCAAAGGCGCCTCCCTGGCGACG
GTGGTGCGTATTTATCAGCTGAAGAACCGGCAAGCGTTCGACAATACTGACTACCCGTCGCTGTTTGCCG
GCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTCGCCTGCGTCCGGGCGAATCGGT
GACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGCGGCCATGTTTATCGATCCAGAC
CTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGATCCGGCGAGGCCGCGCATTATCG
AAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA