SecReT6
Protein ID: 386035393
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14255
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2961485..2962501 [-]
Producthypothetical protein
NoteTssG
UniProt IDG0GIF5
KEGG IDkpo:KPN2242_14255
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.30E-81, Aligned region: 1..299
Protein Sequence: 338 a.a.     [Download]
>gi|386035393|ref|YP_005955306.1| hypothetical protein KPN2242_14255 [Klebsiella pneumoniae KCTC 2242]
MNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGEIRGMDDPEPPRPPAVRVTFMGLYGV
ESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYSYPATFRAGGTDNISQYLLGLAGLGI
PGCAAVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRATVYHHDPCRIPLSQPLTMSVRQPVSL
QHRPVMGIHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMALLHVWLGSHLDVRLQLCVARHLLPDA
QLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENIHRRESDEDGDYRS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2962501-2961485 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACCATCCGAAGGCGCCGATCATCGGCAGCGGCT
GGCTAGTAGGTGATGAACCCATACGCTTTCGCCCGCATCCGGGGATGGGCTTTCCGGCTGGCGAAATCCG
TGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTTCGCGTGACTTTTATGGGACTCTACGGCGTG
GAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGCAACGGCGGGAAGGCGTCGAGGCCACCGAGG
ATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTATTACCGTATCTGGCGCAAATATTCCTACCC
GGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAGTATCTGCTGGGCCTGGCGGGGCTGGGCATA
CCGGGATGTGCCGCCGTTGCCGCAGCGCCGCTGTCGCGATTTCTGGCGCTGCTGCCGGTGATGATGCTGC
CGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCTCCTGGCCCCGGGGACCCGGGCGACGGTGTA
CCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTAACGATGAGCGTCCGTCAGCCGGTTAGCCTG
CAACATAGGCCAGTGATGGGAATCCACGCCACGGATGTGAACGGTCAGGTATTGCTGCAGCTGGCCACGG
AAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGAACTGTTCAGCGACCTGATGGCGCTTCTGCA
CGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTTTGCGTCGCCCGCCATTTACTGCCGGATGCG
CAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCCGTACCGCTGTGCTGCGTCCGCTGGATGCGC
AGAAGCAGGCTGACGACAGAGTCACGATTTATCTGGGGCGCTATCAGCGCGTCCGGGAAAATATCCACCG
CAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA