SecReT6
Protein ID: 386035397
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14275
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2969075..2969332 [-]
Producthypothetical protein
NotePAAR
UniProt IDG0GIF9
KEGG IDkpo:KPN2242_14275
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.00E-24, Aligned region: 5..77
Protein Sequence: 85 a.a.     [Download]
>gi|386035397|ref|YP_005955310.1| hypothetical protein KPN2242_14275 [Klebsiella pneumoniae KCTC 2242]
MKKTICVGDKTSHGGSVLTGSSQIIIDGKSVARKSDLVSCPTHGVNSISEGDEKHCDNGLAVALEGHRCS
CGAILISAGSRVLKE
 
Nucleotide Sequence: 258 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2969332-2969075 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGAAAAAAACTATTTGTGTAGGTGATAAAACATCTCATGGTGGATCTGTCTTAACGGGCTCATCTCAGA
TAATCATTGATGGTAAATCTGTGGCACGTAAGTCTGATCTGGTCTCATGTCCAACACACGGTGTAAATAG
TATAAGTGAGGGAGATGAAAAACATTGCGATAACGGGTTAGCTGTTGCGTTAGAAGGGCACCGCTGTTCA
TGTGGCGCTATTCTTATTTCCGCCGGTTCGCGTGTTTTAAAGGAATGA