SecReT6
Protein ID: 386035402
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14300
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2973199..2975826 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG0GIG4
KEGG IDkpo:KPN2242_14300
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-64, Aligned region: 35..355
DUF2345 [PF10106], Evalue: 1.40E-42, Aligned region: 609..761
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 487..593
T6SS_Vgr [PF13296], Evalue: 6.90E-35, Aligned region: 628..653
Phage_base_V [PF04717], Evalue: 2.00E-15, Aligned region: 387..482
Protein Sequence: 875 a.a.     [Download]
>gi|386035402|ref|YP_005955315.1| ImpA family type VI secretion-associated protein [Klebsiella pneumoniae KCTC 2242]
MDTSSIITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVITTFRRVNRSEDQSTYQITLQPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLP
VNSPSGMSDSGAESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATAEMTRGNGEGITYGEVYHYKLRH
RERGDKIDPQTETANFYARLDHERFLAHQTLITASSTAAWLAPAQVLNVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDADRD
EKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVDAIRKLRGEGFELRTDSWGGIRAGKGIFITAD
SQPEAQGKVLDMAAVHSLLTQAVSQMESLSLAASAAKAQLLQYEQQQALMEEKLLALKQAVLLMSAPEGI
ALASGSHLQAVASENIYMTAGQNVELGAKKNITLAASEKISIFTETEGVEAIVAKGDIISQAQSGNIEVI
AKQNISLTSTTKDMTFTAAKTLTFTCAGGAYIRLSGGNIELGCPGDIMMKQSKLLYSGPASMQSNIPELP
DSGPQSMSFMLLDALGNAAPSTMKVSLFDSESKEQIWNSAFNDGESGCFEQPESKNFHAIIGDDKWTSLF
SYNDVHDIEDETDDDLDFDEHGPQYDGELNEQDKE
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2975826-2973199 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGATACTTCTTCAATAATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTACCG
CATCGCTGGATGTGGAAGAATTCAGTGGGGCAGAAAAACTGAGTGAACTTTATTATTACACTATTACGTT
TACCAGCGCAGAGAAAAATATTGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGC
GGCGCACTGCAGCAGCTGGCGGACTGCAAACGCGTCCATGGTGTGATTACCACCTTCCGGCGCGTCAATC
GTTCTGAAGATCAGTCGACCTATCAGATAACCCTCCAGCCGTTTCTCTCCCTGCTGGATAAACAGTTTCG
CAGCCATCGTTTTTTCGTCAACAAATCGGTACCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTC
CATGACTGGGAGTATGAGTTTAATCTCAAGCAACACTATCCGCGGCGCGAGCAAATTAATCAGTATCAGG
AGAGCGACCTGGCGTTTATCCAGCGCCTGCTGGCAGAGGTGGGGATATTTTATTTCTTCACCCTGCAGGA
AGAGGCCCAGAGCGAAGTGGTCCACTTCGCCGACGCGCAGCGGGCGCTGATGTTCGATAAGACACTTCCT
GTAAACAGCCCGTCCGGGATGAGCGACAGCGGTGCGGAATCGATATGGGGTCTGAGCATCACGCACAATG
TCGTAGAGGCAAACGTCACTACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAAC
AGCGGAAATGACCCGGGGAAATGGTGAAGGCATCACTTACGGTGAGGTATACCACTATAAGCTTCGTCAC
CGGGAGCGTGGCGATAAAATCGACCCGCAGACGGAGACCGCCAACTTCTATGCCCGCCTCGACCATGAGC
GTTTTCTGGCTCACCAGACGCTTATTACCGCGAGCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCT
GAACGTTACCGACAGTCTGCCGTCGACCCTGCCTGCGCCCGTACAGGATCCGCTGTTAATCACCGGCACC
GGTTTTACCGCCAGCCGCCGGGAGGCGCTGCGGGTGTCCCTGCTTGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAA
GGCGAATGATATCTATGCCTGGCAAGATGCGTCCGGCCTGTACCGGGTGAAATTTGACGCTGACAGAGAC
GAGAAAGGGCAGGGTCAGGAAAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGCT
TTCACTTCCCGCTGATCCAGGGCACGGAGGTGGCGATTGCTTTCCACGAAGGCGATCCCGACCGGCCGTA
TATTGCGCATGCGCTGCATGACTCGCGGCATGTCGATCCTGTGACGGAGAAAAACAGCACCCGCAATGTG
ATTCGTACTCCGGCCAATAATAAGCTGCGAATGGAGGACAAGCGCGGCGAGGAGCATATCAAGCTCAGCA
CCGAGTACGGCGGCAAGACGCAGCTGAATTTAGGTCATAACGTTGATGCCATCCGCAAGCTTAGGGGGGA
AGGGTTTGAACTGCGTACCGATTCGTGGGGAGGGATCCGCGCGGGGAAAGGGATATTCATTACTGCGGAC
AGCCAGCCTGAGGCACAAGGGAAAGTGCTGGATATGGCTGCAGTACATTCCTTGTTGACGCAAGCCGTTA
GTCAAATGGAGTCTCTTTCACTGGCAGCATCAGCGGCAAAAGCACAGCTCTTGCAATATGAGCAACAACA
GGCACTGATGGAAGAGAAGTTACTTGCGCTAAAGCAGGCTGTATTACTGATGAGTGCACCAGAAGGTATT
GCTTTAGCCAGTGGAAGTCATCTTCAGGCAGTTGCAAGCGAAAATATTTATATGACTGCAGGGCAAAATG
TTGAACTGGGAGCAAAGAAAAATATTACCCTTGCCGCTTCTGAAAAAATATCAATCTTTACCGAAACTGA
GGGCGTAGAAGCTATTGTAGCTAAAGGTGATATAATATCACAGGCTCAGTCAGGAAATATTGAAGTAATA
GCTAAGCAAAATATTTCGCTGACCAGTACAACAAAGGATATGACTTTTACAGCGGCAAAAACTTTAACGT
TTACCTGTGCTGGCGGGGCATACATTCGCCTTTCCGGAGGAAACATCGAGTTAGGCTGCCCTGGTGATAT
TATGATGAAGCAAAGTAAGCTTCTCTACAGTGGCCCAGCTTCTATGCAGTCAAATATTCCAGAACTTCCT
GATAGTGGTCCACAGTCAATGAGTTTTATGCTGTTAGATGCTCTTGGTAATGCTGCGCCATCTACTATGA
AAGTGAGTCTTTTTGATAGTGAATCAAAAGAACAAATATGGAACTCTGCTTTTAATGATGGAGAGTCAGG
TTGTTTTGAACAGCCTGAAAGTAAAAATTTTCATGCAATAATTGGCGATGATAAATGGACGAGCCTTTTT
TCTTATAACGATGTGCATGATATTGAGGATGAGACTGATGATGACCTGGATTTCGATGAACATGGTCCGC
AATATGATGGTGAATTAAACGAACAAGATAAGGAATAG