SecReT6
Protein ID: 386035404
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14310
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2976288..2977985 [-]
Producthypothetical protein
NoteTagL
UniProt IDG0GIG6, G0GIG6
KEGG IDkpo:KPN2242_14310
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 7.80E-18, Aligned region: 435..531
Protein Sequence: 565 a.a.     [Download]
>gi|386035404|ref|YP_005955317.1| hypothetical protein KPN2242_14310 [Klebsiella pneumoniae KCTC 2242]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQVIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPRLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAAESRWFTITPERAGLQVQLEGQAPQAVAGWQ
REGSSASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAGITTL
SPGNDAAPGPHPLPDLLLSSLPHRHGVSRRMRDVGLAAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSTLKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDKSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGAETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2977985-2976288 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGCGTGATAACGCCCGTCGTCTGCTTACGATACTGACCGTCATCCTGGCCCTGTGGCTGGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGGCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCGGTGGTTCTGGTCTGCGGGGATACCGACGGTCTGTTTCCCGGGCGTTCGGCGCACGGCGAAACCC
GTCACGGCTGGTATCTCCGGGGTGACAGCGCGGAGCAGTTGCCGCGGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGCGCTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CATCTGGCGCAGTCGCTGCGCGACTGGCGGCGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCAGGCGGCCAGGCCGCGGAAAGCCGCTGGTTTACCAT
CACGCCGGAGAGGGCTGGTCTCCAGGTGCAGCTGGAGGGACAAGCGCCCCAGGCGGTTGCCGGGTGGCAG
CGGGAGGGCAGCTCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCAGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTTACGCCGGTGGCGGCGGTGGCGAATAACCTCTGGCAACAGCAAATCGCCGGGATCACCACGCTC
TCCCCGGGCAACGACGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTTCTGTCGTCACTGCCGCACC
GCCACGGGGTCAGCCGCCGGATGCGCGATGTTGGTCTTGCCGCTGGCGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAT
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTGCCGACAGCCGCC
TGCTGGATGACTGGTTGCGCCGGGGGGAGCCGCTGCGTTATCGGCTGGGGCTGTATCAGGGGGGGCGGCT
GATCCCCTTCGTGGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCACGTCCGGTCATTAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGACGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGCGAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAAATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTGCCGGAGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGTCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGGCGGGCGCAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACGCCGGGCACGGCCAATACCTCAGGAGCAGAGACTAACGGATTA
AAAAGCGAAACCGAGTAA