SecReT6
Protein ID: 386035405
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14315
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2977989..2978642 [-]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDG0GIG7
KEGG IDkpo:KPN2242_14315
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.00E-43, Aligned region: 13..205
Protein Sequence: 217 a.a.     [Download]
>gi|386035405|ref|YP_005955318.1| type VI secretion system protein ImpK [Klebsiella pneumoniae KCTC 2242]
MNTSESDLINITFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFYRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSLTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALWLTFSSVLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2978642-2977989 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACATAACTTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACGGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGATGGGTGACCGAGGCGCG
CGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTCGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACTTGTTTCTATCGTACTTTGCAACTGGGGTTTGTCGGACAGTAC
CGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGGGTCCCGCCGTTCAGCC
TGACCCAAGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGCGGCTGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTTCTCCTCCGTGCTGTCACAGATGGTG
GCGCAGATAGCAGGGCAGGGATAA