SecReT6
Protein ID: 386035406
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14320
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2978639..2979979 [-]
Producthypothetical protein
NoteTssK
UniProt IDG0GIG8
KEGG IDkpo:KPN2242_14320
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-130, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|386035406|ref|YP_005955319.1| hypothetical protein KPN2242_14320 [Klebsiella pneumoniae KCTC 2242]
MKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFAD
GTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQYPSRHPELLYRELARLAGSLLTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIVLEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2979979-2978639 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGGTCCCGCAGCAGTTTCAGCAACAGGCCC
GCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCTCGCCCACCCGTGGGGGGTATTGCGCGC
GGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCTACCCGGCTGATCGTGCGTTTCGCCGAC
GGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGGTCCGCGATGTATCGGACGTGATGCAGG
ACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAGCGGCGGCAATCTTGATGACGGCCAGGA
GAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTCCAGGAGCTGGCCGGCCATGAACGCAGC
GAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCACCGAGGAAAATGCAGCCTTCCTCACCT
GCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGATCGTTGACCCGGAATTCATCCCGCCGCT
GCTGTCGCTGGCGGCAAGCCCGACGCTGGTCAGCGAGCTGGGCGAGCTGTTACATCGCCTGCAGGCCCGA
CGCAGACGCCTGATGGCCATGCGCCGTGAAAGCAATGCGCGGATGGCTGATTTTGCCGTGGCGGATGTCT
CCTTGTTCTGGCTGCTCAATGCGCTGAACAGCGCTGAACCGGTGCTCAGCGAGCTGCATCAGTACCCTTC
GCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCCGGCAGTCTGCTGACTTTCTCCCTTGAA
CATCATCTGGAAGCAATCCCCCGCTACCGGCATGCCTCGCCAGAGCAGGTATTCCCACCGCTGTTTGCCC
TGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGATCGCCATCGTTCTGGAGCAGGGCGCCGA
CCGGGAGATCTGGCGGGGCAGGCTGCACGATGCGCGGCTGCGCGAGGGGGCGGATTTTTATCTGTCGGTG
CGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGCAGCTCTGTAAGGCGGGTAGCCATGATG
ATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGATCAAACCGCTGAGCCATGTGCCGGCGGC
CATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTTTCCACCGATGCCGCCCGCGCGATGCTG
GAGGCTGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCGACGTGAAACTTGAACTCTTTGCGGTAC
TGCGCTCATGA