SecReT6
Protein ID: 386056147
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0078
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]89269..89949 [-]
Producthypothetical protein
NoteTagF
UniProt IDG2KZW5
KEGG IDpaf:PAM18_0078
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 6.10E-51, Aligned region: 5..142
Protein Sequence: 226 a.a.     [Download]
>gi|386056147|ref|YP_005972669.1| hypothetical protein PAM18_0078 [Pseudomonas aeruginosa M18]
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGGE
AVAGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLP
APPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRF
LTGEGEVIPLFPGIPG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c89949-89269 Pseudomonas aeruginosa M18 chromosome, complete genome
TTGAACAGCGTCGGTTTCTACGGCAAGCTGGCCGGCCGCGGCGATTTCGTCAGCCGCGGCCTGCCGAACA
CCTTCGTCGAACCCTGGGACGCCTGGCTGGCCAGCGGCATGCGCGCCAGCCAGGACGAACTCGGCGCGGC
CTGGCTCGACGCCTACCTGACCAGCCCGCTGTGGCGCTTCGCCATCGCCCCCGGCCTGCTCGGCGGCGAA
GCGGTGGCCGGGGTGGTGATGCCGAGCATCGACCGGGTCGGTCGCTATTTCCCGCTGACCGTCGCCTGCC
TGCTGCCGGCGAACGCCGACCTCGGCGGGCTGGTCGGCGGCGACGACGGCTGGTTCGAGCAGGTCGAGAG
CCTGCTGCTCTCCACCCTCGAACCGGAGGCCGAGGTCGAGGCCTTCGAGCAGGCGGTGGCGCAGCTCCCG
GCACCGCCCTGCGGACCGCGCATCGAACAATCGCTGATCAGCGGCAACCTGCTGCGCAGCGAAGCGGTGA
CCCCGGCGCAGCGCCTCGCCGCGCTGGCCCAGCACGCCTGCGACGGCGCCAGCCACTGGTGGGGACGCGG
CTCGGCACGGATCTCCGCCGGCCTGATGCGCTACCAGGGCCTGCCGCCGGCGCCGGCGTTCGGACGATTC
CTCACCGGAGAGGGCGAGGTGATCCCGCTCTTTCCCGGCATACCCGGTTAA