SecReT6
Protein ID: 386056150
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0081
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]94829..96163 [-]
Producthypothetical protein
NoteTssK
UniProt IDG2KZW8
KEGG IDpaf:PAM18_0081
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|386056150|ref|YP_005972672.1| hypothetical protein PAM18_0081 [Pseudomonas aeruginosa M18]
MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGFSELKLDDALLTQGKLAIVSARGVLP
DGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPLKRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFES
RAPVALGSQAFRLLTERDGLGEYAAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLL
HQRGEALAGRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQ
RRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLIDNASFVLVVR
ADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPYHAGSTYFELDRGSAHWKQLTH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c96163-94829 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGTCCTGGAATAACCGCGTGGTGTGGTCCGAAGGCATGTTCCTGCGGCCACAACATTTCCAGCAGCACG
ACCGCTACCTGGAAACCCTGGTGGATGGCCGCTGCCGCTCGCTCCTGGCGGGCGGCTGGGGCTTTTCCGA
GCTGAAGCTGGACGATGCCCTGCTGACCCAGGGCAAGCTGGCCATCGTCAGCGCCCGCGGCGTGCTGCCG
GATGGTACGCCGTTCAACATCCCCGCCGACGATCCGGCGCCGGCGCCGCTGAATGTCGAGGAAAGCCTGC
GCGATGGCATCGTCTACCTCGGCCTGCCGCTGAAGCGGGTCGGCACCCGCGACACGGTAGAGGAGGGCGA
GGCCCTCGGCGGCGCCCGCTACGTCAGCCAGGTGCAGGAAGTGCGCGACGACAATGCCGCCTTCGAGAGC
CGCGCCCCGGTGGCCCTGGGCAGCCAGGCGTTCCGCCTGCTGACCGAGCGCGACGGCCTCGGCGAATACG
CCGCGGTGGGCGTCGCGCGGGTCCGCGAGAAGCGCGCGGACCAGGCCCTGAGCCTGGACGAGGACTACCT
GCCGCCGGTGCTCGACATTGCCGCCGCGCCGCCCCTGGCGTCCTTCGCCAAGGAGCTGCTGGGCCTGCTC
CACCAGCGCGGCGAAGCCCTCGCCGGGCGGGTGGTGGCATCCAGCGCCGGGGGCGCCTCGGAAATCGCCG
ACTTCCTGCTGCTGCAACTGGTCAACCGCGCCGAGGCCCTCACCGGTCACCTGTCCCGCGTGCGCCCGCT
GCACCCGCAGGAGCTGTACCGCGAACTGGTGGCCCTGGCCGGCGAGTTCTGTACCTTCACCGCCAGCCAG
CGGCGTCCCGAGGAGTACCCGGTGTACAACCACGACGACCTGGCCGCCAGCTTCGCCCCGGTGATGCTCG
CCCTGCGCCAGGCGCTGGCGACGGTGATCGACGCCAAGGCGATCGCCATCCCGATCGTCGAGAAGGCCTA
CGGCGTGCACGTCGCGATGCTCAGCGACCGCAGCCTGATCGACAACGCCAGCTTCGTCCTGGTGGTGCGC
GCCGACGTCCCCGGCGAGAGCCTGCGCGGGCACTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGTATCGGCCTGCTGCCGATGCCGGTGGCGCCGCGGCAGAT
CCCCTACCACGCCGGCTCCACCTATTTCGAACTGGACCGCGGCAGCGCGCATTGGAAGCAGCTGACGCAC
TCCGGCGGCTTCGCCTTCCACATCGCCGGCCAGTTCCCCGGGCTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA