SecReT6
Protein ID: 386056151
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0082
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]96179..96643 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG2KZW9
KEGG IDpaf:PAM18_0082
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.60E-43, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|386056151|ref|YP_005972673.1| hypothetical protein PAM18_0082 [Pseudomonas aeruginosa M18]
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLAVPGQRTSHLDIT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c96643-96179 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGCAGAAACTGATCGTCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGTTCGTCCAGCCCGCCGGAAACCC
CGCCGACCCGGGTGGTGATCTGGCTCCACGCCGCACCGAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAAGACACCGCGTTCGGCCGCGCCGACTACTTCGCCCTC
ACCGACAACGCCCAGTCGACCCTCGGTGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAACGGCGCATCGAACGCACGCTCGACGAGCAGACCCGCCAGCTCGGTTTCGTCGCCGCCTACCGCGA
CCTCGACCGCGCCACCTGGCGCCAGGTCCTCGCCGTGCCGGGGCAACGCACCAGCCATCTCGACATCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGTCCCGCGCCCTGA