SecReT6
Protein ID: 386056153
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0084
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]98573..99607 [+]
Producthypothetical protein
NoteTssA
UniProt IDG2KZX1
KEGG IDpaf:PAM18_0084
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 156..168
Protein Sequence: 344 a.a.     [Download]
>gi|386056153|ref|YP_005972675.1| hypothetical protein PAM18_0084 [Pseudomonas aeruginosa M18]
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKD
LRVANLLLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALEGALEHALAIESGV
AERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGADESLAPGAEAVADEQVGAAPVAAVAAPAPRASGEIA
NREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|386056071|ref|NC_017548.1|:98573-99607 Pseudomonas aeruginosa M18 chromosome, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCTGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACG
ACGCCGCGTTCCTCGAACTCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCT
GCCCGCCGAACCACCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGAC
CTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGGCTCGCCGACGGCC
TGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGCTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGC
TGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGAAGGCGCCCTGGAACATGCCCTGGCCATCGAGAGCGGCGTC
GCCGAACGGGTCGGCTCGGCCCAGGGACTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGACGAGTCCTTGGCGCCGGGTGCCGAGGCGGTCGCCGA
CGAGCAGGTGGGCGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGAGCCAGCGGCGAGATCGCC
AACCGCGAAGACGTCCTGCGCCAGCTCGACCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGCC
CGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCT
CATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA