SecReT6
Protein ID: 386056154
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0085
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]99696..100214 [+]
Producthypothetical protein
NoteTssB
UniProt IDG2KZX2
KEGG IDpaf:PAM18_0085
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.60E-60, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|386056154|ref|YP_005972676.1| hypothetical protein PAM18_0085 [Pseudomonas aeruginosa M18] [TssB]
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADRKFLEIDVDNF
DARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKT
GAEEMIMKAIKDPALLQALASAPKPKDDEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|386056071|ref|NC_017548.1|:99696-100214 Pseudomonas aeruginosa M18, complete sequence [TssB]
ATGGGAAGCACTACCAGCAGTCAGAAGTTCATCGCCAGGAACCGGGCGCCACGCGTGCAGATCGAGTACG
ACGTGGAGTTGTACGGTGCCGAGAAGAAGGTCCAGCTGCCCTTCGTCATGGGCGTCATGGCCGACCTCGC
CGGCAAGCCCGCCGAACCCCAGGCGGCGGTCGCCGACCGCAAGTTCCTGGAGATCGACGTGGACAACTTC
GATGCCCGGCTGAAGGCGATGAAGCCGCGGGTGGCCTTCAACGTACCGAACGTGCTGACCGGCGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCGGTGGCGCGCAAGGTCGA
TTCGCTGAACAAGCTGCTCGAGGCGCGTACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACC
GGTGCCGAGGAAATGATCATGAAGGCGATCAAGGACCCGGCCCTGCTTCAGGCCCTGGCCAGCGCGCCGA
AGCCCAAAGACGACGAGCCGCAGGCGTAA