SecReT6
Protein ID: 386056156
SecReT6 ID611
T6SS typei3
Gene symbolhcp1
Locus tagPAM18_0087
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]101811..102287 [+]
Producthypothetical protein
NoteTssD
UniProt IDG2KZX4
KEGG IDpaf:PAM18_0087
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-46, Aligned region: 2..133
Protein Sequence: 158 a.a.     [Download]
>gi|386056156|ref|YP_005972678.1| hypothetical protein PAM18_0087 [Pseudomonas aeruginosa M18]
MFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACS
SGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGA
KDGGPVKYGWNIRQNVQA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|386056071|ref|NC_017548.1|:101811-102287 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGGAAATCGACGTGC
TGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGGCGCCGGCAAGGT
CAACGTGCAGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATGATGGCCTGCTCC
AGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACCAGGTCGAGTACC
TGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGTGGCGAGGATCGCCT
GACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAGGCGGATGGCGCG
AAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTGCAGGCCTGA