SecReT6
Protein ID: 386056158
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0089
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]103302..103811 [+]
Producthypothetical protein
NoteTssE
UniProt IDG2KZX6
KEGG IDpaf:PAM18_0089
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|386056158|ref|YP_005972680.1| hypothetical protein PAM18_0089 [Pseudomonas aeruginosa M18]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVLRDLAWLFNTTSLFDHGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|386056071|ref|NC_017548.1|:103302-103811 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGCCGAACTGACCCTTCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAACCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACTTCGCTGTTCGACCACGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGTTGCGGGTGCGCGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGCGACCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA