SecReT6
Protein ID: 386056159
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0090
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]103808..105667 [+]
Producthypothetical protein
NoteTssF
UniProt IDG2KZX7
KEGG IDpaf:PAM18_0090
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-224, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|386056159|ref|YP_005972681.1| hypothetical protein PAM18_0090 [Pseudomonas aeruginosa M18]
MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGALSSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWP
LEVAQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLG
NACAVFVRAPDNAWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRAL
RRCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFE
VHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSKQRRKGPRSTYVGSETFVALVD
ANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLAERGQGAAALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEIT
LDFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|386056071|ref|NC_017548.1|:103808-105667 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAACCCGCGCCTGCTCGAGTACTACAACCAGGAATTGCAACACATCCGCGAAAGCGCCGCGGAGTTCG
CCGAGGAATTCCCGAAGATCGCCGGGCGCCTGTCGCTGTCCGGCTTCGAGTGCGCCGACCCCTACGTCGA
GCGCCTGCTGGAAGGCTTCGCCTATCTCACAGCGCGGGTCCAGCTGAAGCTCGACGCGGAGTACCCGACC
TTCACCCACAACCTGTTGGAAATCGCCTACCCGCACTACCTGGCGCCGACCCCGTCGATGACCGTGGTGC
AGTTGCGCCCGGACCCCAACGAAGGCGCCCTGAGCAGCGGCTTCAGCGTCGAGCGCGGGGCCTCCCTGCG
CGGCCAGCTCGGCCCCGATGACCAGACCGCCTGCGAATACCGCACCGCCCACCCGGTGACCCTGTGGCCG
CTGGAAGTGGCCCAGGCCGACTACTTCGGCAATCCCGCCGCGGTGCTCGGCCGCCTCGCCGCCAGCGAGC
CGCGGGCCAAGGCCGGCCTGCGCATCCGCCTGCGCAGCGGCGCCGGCATCCCGTTCGACAGCCTGTCGCT
GGACGCCCTGCCGCTCTACCTGCACGGCGCCGACGAACAACCCTACCGCCTCTACGAACAATTGCTCGGC
AACGCCTGCGCGGTGTTCGTCCGCGCCCCGGACAATGCCTGGGTCGAACGCCTGCCGACGAGCAGCCTGC
GTGCGCGCGGCTTCGACGACGAGGACGCGCTGCTGCCGGTGGTGCCGCGGGCGTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCGGCGCGCTTCCTGTTCGTCGAGTTCTCCGGCCTGAACCGCGCCCTG
CGTCGATGCCACGGCGAGGAGCTGGAACTGGTCGTGCTGTTCGGCAAGCACGACCAGCGCCTGGAGGGCA
CGGTGGACGCGGAGCAACTGGTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGCGCCGCTGCGACCG
CATCCACCTGTCCGACCGGGTCAACGAGCATCACGTGATCGTCGACCGCACCCGTCCGCTGGATTTCGAG
GTGCATTCGCTGCAACAGGTGAGCGGCCACGGCAGCGGTCCGGAGCAACCCTTCCAACCGTTCTATGCGG
TGCGCGACCCGGCGCGCTACGGCCGCGAGCAGGCCTACTTCAGCGTGCGCCGCGAACCGCGCGTGCTGTC
CAGCAAGCAGCGGCGCAAGGGCCCGCGCTCGACCTACGTCGGCAGCGAGACCTTCGTCGCCCTGGTCGAC
GCCAACCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGCATCGCCGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGCCGATCGGCGCGCACAAGAGCGACTTCACCCTGGAGGACAGCGCGCCGGTCATGCA
GGTGCGCTGCCTCGCCGGACCGAGCCGGCCGCGCGCCAGCCGTGCCCACGATGCCAGCGCCTGGCGGCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGCTGGCCGAGCGCGGCCAGGGCGCCGCCGCCCTGCGCGAGC
TGCTGCGGCTCTACGGCGACAGCGGCGATCCGGCGCTGCAATTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAGCCTTGCACGCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGTGGCCTGGAGATCACC
CTGGACTTCGACGAGAACGCGTTCCGCGGCACCGGGGTGTTCCTTCTCGGCGCTGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGCTGCGCACCGGCGAACGGGGCGAGGTGAT
GAGATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGA