SecReT6
Protein ID: 386056160
SecReT6 ID611
T6SS typei3
Gene symbol-
Locus tagPAM18_0091
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]105631..106677 [+]
Producthypothetical protein
NoteTssG
UniProt IDG2KZX8
KEGG IDpaf:PAM18_0091
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-112, Aligned region: 20..319
Protein Sequence: 348 a.a.     [Download]
>gi|386056160|ref|YP_005972682.1| hypothetical protein PAM18_0091 [Pseudomonas aeruginosa M18]
MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLGHSVRLADDPLRLGQKPDCTFAPSTL
ASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEA
RPEISHDRIDDDYWSARLAALSGRGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVA
VEEYVGQWLELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWV
AEYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPHEHKEKEHE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|386056071|ref|NC_017548.1|:105631-106677 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGAACCTGCTCGCCGGGATGGCGGCGGCGCCCTGGG
ACTATGACTTCTTCCAGGCGCTGCGGCGCATCGAGTGCGAGTCGCCGCAACTGCCGCGCCTCGGTCATTC
GGTGCGGCTGGCGGACGACCCGCTGCGTCTCGGGCAGAAGCCCGACTGCACCTTCGCGCCCTCGACCCTG
GCCTCGGTGAGCCAGGCCGGCACCGCTGCGGTGCCGCGCCTGGACCAGTTCTTCTTCGGCCTCACCGGCC
CCAACGGGCCGCTGCCGCTGCACCTCACCGAATACGCCCGGGAACGCCAGCGCAACGTCAACGACGCGAC
CTTCAAGCGCTTCATGGACGTCTTCCACCACCGCCTGCTGACCCTGTTCTACCGGGCCTGGGCCGAGGCG
CGGCCGGAGATCAGCCACGACCGGATCGACGACGACTACTGGTCGGCGCGCCTCGCCGCGCTCTCCGGGC
GCGGCATGCCGAGCCTGCGGGGGCGCGAGCCGCTGGCGGATACCGCACGCTACTACTACACCGGCCACCT
CGCCGCGCAGACCCGCTACCCGGACGGCCTGCGGGTGATCCTCGCGGAGTATTTCGAGGTCCCGGTGGCG
GTCGAGGAATACGTCGGCCAATGGCTGGAGCTGCCCGAGCGCAGCCGCCTCGGCGTCGACTCGACGAGCC
TGGGCATGGACGTCTGCCTGGGCACCCACGTCTGGGACCGCCAGCACAAGTTCCGCCTGCGCCTGGGGCC
GCTGGACCTCGATCAATACCAGCGCTTCCTGCCCGACGGCGACCACTTCGTCGAGCTGGCCGCCTGGGTC
GCCGAATACCTGGGCGAGGAGCTGGACTGGGACGTCAACCTGGTCCTGCAACGCCACGAAGTACCCCCGC
TGGGCCTGCAGGGCGGCGGGCGGCTCGGTTTCAACACCTGGCTGGGCGATCCCGGCCAGGACGCCAGGGA
TCTACTGCTGGCCCGCCAGTACGCCACTGCGCGGCCGCACGAGCACAAGGAGAAGGAACATGAGTGA