SecReT6
Protein ID: 386058734
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2671
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2972823..2973839 [-]
Producthypothetical protein
NoteTssG
UniProt IDG2L1D2
KEGG IDpaf:PAM18_2671
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-79, Aligned region: 18..318
Protein Sequence: 338 a.a.     [Download]
>gi|386058734|ref|YP_005975256.1| hypothetical protein PAM18_2671 [Pseudomonas aeruginosa M18]
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLLPLFASSEVES
LLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHAPAEFLDLFQHRLLSLLYRVLRKHRVALG
FAVPAATPVQAQLRALSGLLPKALHERLALPDSAVLARTALFAGGRRSLAGFAGLVRQHFGVEARLDAYQ
GAWKEIPTASRSRLQRGGRNLRLGRDAIAGTRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAA
LYFGPDLDCRLSLLVSGGAPLRLERGTPPRLSWNTGLRRIEDGQRQRIDLDLRQPEVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c2973839-2972823 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGAGTCAGCGGCTGCGCCGCACGCCGCAGCGCTTCG
AACTGTTGCAGGCGCTGCTGCTGCTCGAACGCGAGCGTCCCCAGGCGTTGCCGCTGGGCACCGGCAACGC
GCCGCGGGCGGAGGCCCTGCGCCTGCGCGGGCCGCTGTTGCCACTGTTCGCCTCGAGCGAGGTGGAAAGC
CTGCTCGACGACCCGCAGCAACCGGTGCTGTCCACCCCGGTGTTCGGTCTCGGCGGACCCGACGGCCCGT
TGCCCTATGCCTACCAGGAATGGCTGCAACAACGCGCCCGGCAGAAGGACCATGCCCCCGCCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTGCTGCGCAAGCATCGCGTGGCGCTCGGT
TTCGCGGTGCCGGCGGCGACCCCGGTGCAGGCGCAGCTACGTGCCCTCAGCGGCCTGTTGCCAAAAGCCC
TGCATGAGCGCCTGGCGCTGCCGGACAGCGCGGTGCTGGCACGCACCGCGCTGTTCGCCGGCGGGCGTCG
CTCCCTGGCCGGCTTCGCCGGCCTGGTGCGCCAGCACTTCGGCGTGGAGGCACGGCTGGACGCCTACCAG
GGCGCCTGGAAGGAAATCCCCACGGCCAGCCGCAGCCGGCTGCAACGCGGCGGGCGCAACCTGCGCCTGG
GTCGCGATGCCATAGCCGGCACGCGCACCTGGGACGAACACGCCGGCATCGCCCTCAGCCTCGGTCCGCT
GGATGCCCGCGAGGCCGCCCGCTTCTTCCCCGACGGCGACGCCCATGGCCAGTTGGCCAGCCTCGCCGCG
CTGTACTTCGGCCCCGACCTGGATTGTCGCCTGAGCCTGCTGGTGAGCGGCGGCGCGCCGCTGCGCCTGG
AGCGCGGTACACCGCCCAGGCTGAGCTGGAACACCGGCCTACGGCGCATCGAAGACGGCCAGCGGCAGCG
CATCGATCTCGACCTGCGGCAGCCGGAGGTAGCCTGA