SecReT6
Protein ID: 386058735
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2672
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2973803..2975596 [-]
Producthypothetical protein
NoteTssF
UniProt IDG2L1D3
KEGG IDpaf:PAM18_2672
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-181, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|386058735|ref|YP_005975257.1| hypothetical protein PAM18_2672 [Pseudomonas aeruginosa M18]
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGNLAEGYRLPRDTALFVTTRGGDSVHFRSSAEATL
WPLAIDEATLLGGEEAQALTGVGAARSALRLSLRCLGEYRWDELSIERLRIHLAASPMGCAILYDLLAAH
AVQVMAGAPGTPPAALRGLPEIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADGQ
TLYLYLVFDRAPTARLHLQAEDFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAV
RSVAGSTVQPVPAYYGCRHDSHLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLRETPAFSLTAELL
CTNRYLAERLGAGTALGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSLVEGPRALEAL
REILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGASGVLFSAVLA
QFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c2975596-2973803 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAGCGATTCGATTGATGCCGACCTGCTCGACTACTACCAGCGCGAGCTGACCTGGCTACGGCACGCCG
GCGGCGCCTTCGCCGAGCGCTATCCGAAGGTCGCCCGGCGCCTGCAACTGGCTCCCGGCGAATGCCCCGA
CCCGCACGTCGAGCGCCTGCTGGAAGGTTTCTCGCTGCTCACCGCGCGCCTGCAACGGCGCCTCGACGAC
GACTACGCAGAGTTCAGCGACGCCCTCCTCGAACAGCTCTACCCCCTGGCGCTGCGCCCGCTGCCGTCCT
GCGCGATCGTCCAGTTCGAACCGGACCCGACCCAGGGCAACCTCGCCGAGGGCTACCGGCTGCCGCGCGA
CACCGCGCTGTTCGTCACCACCCGTGGCGGCGACAGCGTGCATTTCCGCAGCAGCGCCGAGGCGACCCTG
TGGCCGCTGGCGATCGACGAAGCGACCCTGCTCGGCGGCGAGGAGGCGCAAGCCCTGACCGGAGTCGGCG
CCGCCCGCTCGGCGTTGCGCCTGAGCCTGCGCTGCCTGGGCGAGTACCGCTGGGACGAACTGTCGATCGA
GCGCCTGCGCATCCACCTGGCGGCTTCGCCGATGGGCTGCGCGATCCTCTACGACCTGCTCGCCGCGCAT
GCCGTGCAGGTCATGGCGGGGGCGCCCGGCACGCCGCCGGCGGCGCTCCGCGGACTGCCGGAGATCGTCG
GCTTCGCCGCCGACGAGGCGCTGCTGCCGGAGGAAGACGGCGGACATCCGGGCCTGCGCCTGCTCGCCGA
GTACTTCGCCTTCCCCGACAAGTTCCACTTCTTCGACCTGCCACTGTCCGGCGCGCTCGCCGACGGACAG
ACGCTCTACCTGTACCTGGTCTTCGATCGCGCACCGACGGCACGCCTGCATTTGCAGGCGGAAGACTTCC
AGCTCGGCTGCGCGCCGGCGATCAACCTCTTTCCGCGGACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAGTACCGCCTGGTCGCCGACAGTCACCGCGAGAACAGCGTGGAAATCCATAGCATCCGCGCCGTG
CGCTCGGTTGCCGGGAGCACCGTGCAGCCAGTCCCGGCCTACTATGGCTGCCGCCACGACAGCCACCTCG
GCACGCTCTACTGGCACGCCCGGCGCATCGCCGGGCTGACCCCGAACCGGCTGGGCAGCGATCTGCTGCT
GAGCCTGGTGGATACCGGCTTCGACCCGTTGCGCGAGACCCCGGCCTTCAGCCTGACCGCCGAGCTGCTA
TGCACCAATCGCTATCTGGCCGAGCGCCTGGGTGCCGGCACCGCGCTGGGCTTCGAACGGCCCGGGCCGG
TCGCCGCCGCACGCCTGCGCAACGCGCCCAGCGCGCAGAGCCAGCCGCGCCTGGACGGCCAATCGCGCTG
GAGACTGGTCTCGCAGCTGACCCTCAACCACCTCTCGCTGGTGGAAGGCCCGCGCGCCCTCGAAGCCCTG
CGGGAAATCCTCGCCCTGCACAACCTGCGCGACGACGCCAGCGCCCGCCGGCAGATAGAAGGGCTGAGGC
AACTCGACTGCCAGCGGGTGGTGGCGCACGTCGGCGAGGATGCCTGGCGCGGCTGGCGCAATGGCCTGGA
AATCCGCCTGCGACTCGATCCGCAACACTTCGTCGGCGCCAGCGGCGTGCTGTTCTCCGCCGTGCTGGCG
CAGTTCTTCTCGCTGTATGCCACCGCCAACCGCTTCGTGCGCACGGTCCTGGTGGAAGCCGACAAGGAGG
TGAAGACATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGA