SecReT6
Protein ID: 386058737
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2674
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2976018..2976515 [-]
Producthypothetical protein
NoteTssD
UniProt IDG2L1D5
KEGG IDpaf:PAM18_2674
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|386058737|ref|YP_005975259.1| hypothetical protein PAM18_2674 [Pseudomonas aeruginosa M18]
MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTL
NEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAASTWDLAANQLVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c2976515-2976018 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGATGCGATCATTCTCGATTTCGGCAGCGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACA
AGATCGAAATCATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCAAACCCCACGTCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCGACCCTC
AACGAGTATTGCTGCGCCGGCAAGCCGATCGCCGAGGCGACCATCACCATCGGGCGCAACGCCGCCGAGG
GCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTAGAGACCCTGTCGCTGAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACCAGCTGG
TCAAGTGA