SecReT6
Protein ID: 386058741
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2678
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2979386..2980717 [+]
Producthypothetical protein
NoteTssK
UniProt IDG2L1D9
KEGG IDpaf:PAM18_2678
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.70E-69, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|386058741|ref|YP_005975263.1| hypothetical protein PAM18_2678 [Pseudomonas aeruginosa M18]
MSVLPDAVCWHEGMQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAIL
PDGLPVSVQAGVDAPLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEH
PEPITVWRASLRLVGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKA
LFLGGRLRLAQQAGNQDDAVEIRRQLAALWTRLPEVEGLLASRTASPLALHGSLLGLAGAWAALDPLAGV
PAFEALDFLDLRRGYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGE
QAAADWLERAIVASDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVA
PVSGVASSPWQIVLFVADGSDNT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|386056071|ref|NC_017548.1|:2979386-2980717 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAGTGTTCTGCCTGACGCGGTGTGCTGGCACGAAGGGATGCAACTGCTTCCCCAGCATTTCCAGTTGC
AGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGACAGGCCTGCAACCCTTGGTTCTGGGGAGTGAC
CGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCAAGTGCGGGTCCTGCACCTCGAAGCGATCCTG
CCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGATGCGCCGCTGGAGTTCGATCTGGAGACAGCGC
TGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGGCGGTCAGTCCGCTGTGGCGGGCGGGTCAGTT
GCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGCGCCGCTGCCGGACCTGGCCAGCGGCGAGCAC
CCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTGGTCGGCGACGACGGCAAGGCCGACTCCGTGT
GCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCTACGTCAGCCTGCCCTACGTCCCGCCGACGCC
ACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCAGTCGCTCTGCGCGCGGGCCCGGGAGAAGGCG
CTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAACAGGCGGGCAACCAGGACGACGCGGTGGAAATCCGTC
GCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCGAAGGCCTGCTGGCAAGCCGTACGGCCTCGCC
GCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGCCTGGGCGGCGCTCGATCCGCTGGCCGGCGTG
CCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGTGGCTACGAGCCGCTGCTGGACTGGCTGGAGC
GCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGCCGTTCGAGCAGGAGGAACAGGTATTTTCCGT
GCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGTCGGCCTGCGGATGCCCGCCGGCGCCGGCGAA
CAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCCTCCGACCCGCACCTGCCGTTGCTCGCCCGGC
AACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCCAGGAACAGGTGGCCTACAGCGTTGGCGACGA
CACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTTCGATGCCGGCCAGCCGCTGCGCATCGTCGCG
CCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTGCTGTTCGTCGCCGACGGCAGCGACAACACCT
AG