SecReT6
Protein ID: 386058742
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2679
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2980735..2981493 [+]
Producthypothetical protein
NoteTssL
UniProt IDG2L1E0
KEGG IDpaf:PAM18_2679
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|386058742|ref|YP_005975264.1| hypothetical protein PAM18_2679 [Pseudomonas aeruginosa M18]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|386056071|ref|NC_017548.1|:2980735-2981493 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAACCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGGGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGACAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGTTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCCGCCGCTGCGCCGCCACGGCGTCTGCCGGTGCGCGCAGCGCTGCCGGACGGC
TTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGTTGATGAGCGGTATCGGACACCTGTTCTGGCGCG
ACATCCAGCACGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA